Ivydene Gardens Plant with Photo Index Gallery:
Page C 1

Plant Name with link to its page in Ivydene Gardens:-
If this is a Rock, Wall, Paved or Water Garden Plant, then a thumbnail will be inserted in one of the 53 Flower Colour Comparison Pages in the
Rock Plant Flowers 53 Gallery. Other plants will go into their type of plant Comparison Page Gallery, like Bulb, Climber, etc.

If the image has IMG or PICT in its filename, then it is a Passthrough Camera Image of usually 4000 x 3000 pixels and it will take a long time to load on your screen. Click on it and drag it to your desktop to use it.

Type of Plant with Thumbnail

Comments
If the Image is copyrighted to
Garnons-Williams or Foord, then it is in the Public Domain and you may download it and use it. Many of the Images published within Ivydene Gardens have the copyright name appended to the Image filename.

Coleus Bedding Trial Solenostemon 1 IMG 9558.JPG
'Alligator Tears'

1 Bedding

Coleusbeddingtrialsolenostemon1IMG9558indexgarnonswilliams

The rest of these Coleus Bedding Trial plants of Trial Ground in Garden at Wisley are in the S page.

Central climbing support in white garden IMG 2118.JPG

2 Climbing Rose

fIMG2118indexcentralclimbingsupportinwhitegardengarnonswilliams

Metal support for climbing rose in White Garden in Sissinghurst Castle Garden

Chaenomeles x 'Knap Hill Scarlet' IMG 2135.JPG

Chaenomeles x superba 'Knap Hill Scarlet' IMG 2136.JPG

3 Deciduous Shrub

fIMG2135indexchaenomelesknaphillscarletplantsupportsgarnonswilliams

It was not spaced out fan-wise in Sissinghurst Castle Garden.

Chaenomeles speciosa 'Sanguinea Plena'
IMG 2002.JPG

Chaenomeles speciosa 'Sanguinea Plena'
IMG 2003.JPG

4 Deciduous Shrub

fIMG2002indexchaenomelesspeciosasanguineaplenaplantsupportsgarnonswilliams

In Sissinghurst Castle Garden

Clematis 'Asao' IMG 2044.JPG

5 Climber

fIMG2044indexclematisasaoplantsupportsgarnonswilliams

May not be pruned correctly in Sissinghurst Castle Garden.

Clematis montana 'Marjorie' IMG 2017.JPG

Clematis montana 'Marjorie' support system IMG 2018.JPG

6 Climber

fIMG2017indexclematismontanamarjorieplantsupportsgarnonswilliams

Bit of a mess in its support in Sissinghurst Castle Garden.

 

I tend to use a different support system.

Climbing rose support next to pigeon loft IMG 2099.JPG

7 Climber

fIMG2099indexclimbingrosesupportnexttopigeonloftgarnonswilliams

Problems in Sissinghurst Castle Garden.

Camellia x williamsii 'J.C. Williams' IMG 2102.JPG

Camellia x williamsii 'J.C. Williams' IMG 2103.JPG

8 Evergreen Shrub

fIMG2102indexcamelliajcwilliamsplantgarnonswilliams

Perhaps it could have been pruned in Sissinghurst Castle Garden.

 

Evergreen foliage and flowers.

Cistus x corbariensis IMG 2108.JPG

9 Evergreen Shrub

fIMG2108indexcistusxcorbariensisplantgarnonswilliams

Foliage. No pruning required in Sissinghurst Castle Garden.

Cornus controversa 'Variegata' IMG 2021.JPG

Cornus controversa 'Variegata' IMG 2020.JPG

10 Deciduous Shrub

fIMG2021indexcornuscontroversavariegataplantgarnonswilliams

Was it trained? in Sissinghurst Castle Garden.

Campanula lactiflora
'Loddon Anna'
IMG_1872.JPG

11 Herbaceous Perennial

eIMG1872indexcampanulalactifloraloddonannaplantsupportsgarnonswilliams

Plant Support in Mixed Borders at RHS Garden in Wisley.
Its plant label is broken into 2 sections. The half on the ground will not be visible when the surrounding plants have grown.

Centaurea atropurpurea
IMG 1945.JPG

12 Herbaceous Perennial

eIMG1945indexcentaureaatropurpureaplantsupportsgarnonswilliams

Plant Support in Mixed Borders at RHS Garden in Wisley.

Clematis 'Viola'
IMG 1954.JPG

13 Climber

eIMG1954indexclematisviolaclimbersupportsgarnonswilliams

Plant Support in Mixed Borders at RHS Garden in Wisley. Incorrectly pruned.

Clematis x bonstedtii
IMG 1959.JPG

14 Herbaceous Perennial

eIMG1959indexclematisxbonstedtiiclimbersupportsgarnonswilliams

Plant Support in Mixed Borders at RHS Garden in Wisley.
This Clematis is not a climber, but there is a climber within the same plant support structure without a label

Catalpa bignonioides aurea
IMG 1964.JPG

15 Deciduous Tree

eIMG1964indexcatalpabignonioidesaureaplantgarnonswilliams

Plant without Support in Mixed Borders at RHS Garden in Wisley.
Incorrectly pruned.

Chionodoxa sardensis IMG_1978.JPG

Chionodoxa sardensis
IMG 1979.JPG

16 Bulb

eIMG1978indexchionodoxasardensisplantgarnonswilliams

Plant without Support in Mixed Borders at RHS Garden in Wisley.

Clematis viticella 'Alba Luxurians' IMG 1870.JPG

17 Climber

eIMG1870indexclematisalbaluxuriansclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect training.

Clematis 'Fukuzono'
IMG 1880.JPG

18 Climber

eIMG1880indexclematisfukuzonoclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect support height.

Clematis jackmanii and
Clematis jackmanii
IMG 1887.JPG

19 Climber

eIMG1887index2ofclematisjackmaniiclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis jackmanii
IMG 1883.JPG

20 Climber

eIMG1883indexclematisjackmaniiclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis jackmanii
IMG 1889.JPG

Clematis jackmanii
IMG 1890.JPG

21 Climber

eIMG1889indexclematisjackmaniiclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis texensis 'Kaiu'
IMG 1965.JPG

22 Climber

eIMG1965indexclematiskaiuclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis viticella 'Madame Julia Correvon' IMG 1934

23 Climber

eIMG1934indexclematismadamejuliacarrevonclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis integrifolia 'Pink Ice' IMG 1927.JPG

24 Climber

eIMG1927indexclematispinkiceclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis 'Purpurea Plena Elegans' (Clematis viticella 'Elegans Plena') IMG 1962.JPG

25 Climber

eIMG1962indexclematispurpureaplenaelegansclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley. Incorrect pruning.

Clematis rosemoor evipeo002 (Clematis [Rosemoor] )
IMG 1916.JPG

26 Climber

eIMG1916indexclematisrosemoorevipe002climbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley.

Cornus alba 'Aurea'
IMG 1948.JPG

27 Deciduous Shrub

eIMG1948indexcornusalbaaureaplantgarnonswilliams

Plant without Support in Mixed Borders at RHS Garden in Wisley.
Incorrectly pruned.

Clematis x diversifolia
IMG 1961.JPG

28 Climber

eIMG1961indexclematisxdiversifoliaclimbersupportsgarnonswilliams

Climber Support in Mixed Borders at RHS Garden in Wisley.

Chaenomeles speciosa 'Sanguinea Plena' IMG 2003.JPG

29

fIMG2003indexchaenomelesspeciosasanguineaplenaplantsupportsgarnonswilliams1

 

Chaenomeles speciosa 'Sanguinea Plena' IMG 2004.JPG

30

fIMG2004indexchaenomelesspeciosasanguineaplenaplantsupportsgarnonswilliams1

 

Chaenomeles x superba 'Knap Hill Scarlet' IMG 2136.JPG

31 Shrub

fIMG2136indexchaenomelesknaphillscarletplantsupportsgarnonswilliams

 

Clematis montana 'Marjorie' support system IMG 2018.JPG

32

fIMG2018indexclematismontanamarjoriesupportsystemplantsupportsgarnonswilliams1

 

Cynara cardunculus
IMG 5550.JPG

Cynara cardunculus
IMG 5551.JPG

33

iIMG5550indexcynaracardunculussissinghurstgarnonswilliams

 

Ceanothus concha
IMG 0015.JPG

Ceanothus concha
IMG 0016.JPG

Ceanothus concha
IMG 0017.JPG

34

jIMG0015indexceanothusconchahydehallgarnonswilliams

 

Centaurea montana 'Alba'
IMG 0064.JPG

35

jIMG0064indexcentaureamontanaalbahydehallgarnonswilliams

 

Calanthe striata May 68
PICT00740.JPG

Photo taken by Ron or Christine Foord

36

bPICT00740indexcalanthestriatamay68foord

When I have completed the conversion of all the slides from Ron and Christine Foord and inserted a relevant selection of the digitised images into the Photo Garden Flowers Galleries in some months time, then I will complete their text field in the thumbnail row starting with the letter A (11 November 2020).

Calceolaria biflora Jul 71
PICT00738.JPG

Photo taken by Ron or Christine Foord

37

bPICT00738indexcalceolariabiflorajul71foord

 

Calendula arvensis -
Field Marigold
Sep 78
PICT00728.JPG

Photo taken by Ron or Christine Foord

38

cPICT00728indexcalendulaarvensisfieldmarigoldsep78foord

 

Calendula arvensis -
Field Marigold
Sep 78
PICT00730.JPG

Photo taken by Ron or Christine Foord

39

cPICT00730indexcalendulaarvensisfieldmarigoldsep78foord

 

Calendula officinalis Oct 78
Pot Marigold
PICT00733.JPG

Photo taken by Ron or Christine Foord

40

cPICT00733indexcalendulaofficinalisoct78potmarigoldfoord

 

Callistemon citrinus 09 91
Bottle Brush
PICT00742.JPG

Photo taken by Ron or Christine Foord

41

cPICT00742indexcallistemoncitrinus0991bottlebrushfoord

 

Callistemon citrinus 09 91
Bottle Brush
PICT00741.JPG

Photo taken by Ron or Christine Foord

42

cPICT00741indexcallistemoncitrinus0991bottlebrushfoord

 

Caltha palustris May 85
PICT00745.JPG

Photo taken by Ron or Christine Foord

43

cPICT00745indexcalthapalustrismay85foord

 

Camellia japonica 20 4 68
Sheffield Park
PICT00756.JPG

Photo taken by Ron or Christine Foord

44

cPICT00756indexcamelliajaponica20468sheffieldparkfoord

 

Camellia japonica 20 4 68
Sheffield Park
PICT00754.JPG

Photo taken by Ron or Christine Foord

45

cPICT00754indexcamelliajaponica20468sheffieldparkfoord

 

Camellia japonica 20 4 68
Sheffield Park
PICT00758.JPG

Photo taken by Ron or Christine Foord

46

cPICT00758indexcamelliajaponica20468sheffieldparkfoord

 

Camellia japonica 20 4 68
Sheffield Park
PICT00752.JPG

Photo taken by Ron or Christine Foord

47

cPICT00752indexcamelliajaponica20468sheffieldparkfoord

 

Camellia japonica
'Adolphe Audusson'
PICT00748.JPG

Photo taken by Ron or Christine Foord

48

cPICT00748indexcamelliajaponicaadolpheaudussonfoord

 

Camellia japonica
'Adolphe Audusson'
05 87
PICT00755.JPG

Photo taken by Ron or Christine Foord

49

cPICT00755indexcamelliajaponicaadolpheaudusson0587foord

 

Campanula andrewsii 18 6 67
PICT00759.JPG

Photo taken by Ron or Christine Foord

50

cPICT00759indexcampanulaandrewsii18667foord

 

Campanula barbata 12 7 64
PICT00760.JPG

Photo taken by Ron or Christine Foord

51

cPICT00760indexcampanulabarbata12764foord

 

Campanula barbata 12 7 64
PICT00761.JPG

Photo taken by Ron or Christine Foord

52

cPICT00761indexcampanulabarbata12764foord

 

Campanula barbata 12 7 64
PICT00762.JPG

Photo taken by Ron or Christine Foord

53

cPICT00762indexcampanulabarbata12764foord

 

Campanula carpatica Aug 70
PICT00763.JPG

Photo taken by Ron or Christine Foord

54

cPICT00763indexcampanulacarpaticaaug70foord

 

Campanula carpatica Aug 70
PICT00765.JPG

Photo taken by Ron or Christine Foord

55

cPICT00765indexcampanulacarpaticaaug70foord

 

Campanula carpatica Jul 78
PICT00764.JPG

Photo taken by Ron or Christine Foord

56

cPICT00764indexcampanulacarpaticajul78foord

 

Campanula cashmeriana Oct 71
PICT00772.JPG

Photo taken by Ron or Christine Foord

57

cPICT00772indexcampanulacashmerianaoct71foord

 

Campanula cashmeriana Oct 71
PICT00771.JPG

Photo taken by Ron or Christine Foord

58

cPICT00771indexcampanulacashmerianaoct71foord

 

Campanula cochlearifolia 'Alba' Aug 79
PICT00782.JPG

Photo taken by Ron or Christine Foord

59

cPICT00782indexcampanulacochlearifoliaalbaaug79foord

 

Campanula x wockei 'Puck' Jul 72
PICT00780.JPG

Photo taken by Ron or Christine Foord

60

cPICT00780indexcampanulaxwockeipuckjul72foord

 

Campanula cochlearifolia pusilla
PICT00784.JPG

Photo taken by Ron or Christine Foord

61

cPICT00784indexcampanulacochlearifoliapusillafoord

 

Campanula cochlearifolia pusilla Sep 70
PICT00786.JPG

Photo taken by Ron or Christine Foord

62

cPICT00786indexcampanulacochlearifoliapusillasep70foord

 

Campanula garganic Jul 69
PICT00787.JPG

Photo taken by Ron or Christine Foord

63

cPICT00787indexcampanulagarganicjul69foord

 

Campanula glomerata 07 85
PICT00791.JPG

Photo taken by Ron or Christine Foord

64

cPICT00791indexcampanulaglomerata0785foord

 

Campanula glomerata 07 85
PICT00792.JPG

Photo taken by Ron or Christine Foord

65

cPICT00792indexcampanulaglomerata0785foord

 

Campanula incurva Jul 76
PICT00798.JPG

Photo taken by Ron or Christine Foord

66

campanulaincurvajul76PICT00798

 

Campanula incurva Jul 72
PICT00795.JPG

Photo taken by Ron or Christine Foord

67

campanulaincurvajul72PICT00795

 

Campanula isophylla Aug 71
PICT00800.JPG

Photo taken by Ron or Christine Foord

68

campanulaisophyllaaug71PICT00800

 

Campanula isophylla Aug 71
PICT00801.JPG

Photo taken by Ron or Christine Foord

69

campanulaisophyllaaug71PICT00801

 

Campanula isophylla 07 80
PICT00807.JPG

Photo taken by Ron or Christine Foord

70

campanulaisophylla0780PICT00807

 

Campanula isophylla album
Nov 72
PICT00804.JPG

Photo taken by Ron or Christine Foord

71

campanulaisophyllaalbumnov72PICT00804

 

Campanula isophylla Aug 71
PICT00803.JPG

Photo taken by Ron or Christine Foord

72

campanulaisophyllaaug71PICT00803

 

Campanula linarifolia 17 5 71
in Liechenstein
PICT00810.JPG

Photo taken by Ron or Christine Foord

73

campanulalinarifolia17571inliechensteinPICT00810

 

Campanula linarifolia 17 5 71
in Liechenstein
PICT00809.JPG

Photo taken by Ron or Christine Foord

74

campanulalinarifolia17571inliechensteinPICT00809

 

Campanula linarifolia 17 5 71
in Liechenstein
PICT00811.JPG

Photo taken by Ron or Christine Foord

75

campanulalinarifolia17571inliechensteinPICT00811

 

Campanula medium 07 90
Canterbury Bells
PICT00812.JPG

Photo taken by Ron or Christine Foord

76

campanulamedium0790canterburybellsPICT00812

 

Campanula persicifolia Jul 84
PICT00813.JPG

Photo taken by Ron or Christine Foord

77

cPICT00813indexcampanulapersicifoliajul84foord

 

Campanula persicifolia Jul 84
PICT00822.JPG

Photo taken by Ron or Christine Foord

78

cPICT00822indexcampanulapersicifoliajul84foord

 

Campanula persicifolia 07 85
Foxgloves and Sweet Briar
PICT00815.JPG

Photo taken by Ron or Christine Foord

79

cPICT00815indexcampanulapersicifolia0785foxglovesandsweetbriarfoord

 

Campanula persicifolia 'Alba'
06 90
PICT00814.JPG

Photo taken by Ron or Christine Foord

80

cPICT00814indexcampanulapersicifoliaalba0690foord

 

Campanula poscharskyana
10 10 68 in Rochester
PICT00841.JPG

Photo taken by Ron or Christine Foord

81

cPICT00841indexcampanulaposcharskyana101068inrochesterfoord

 

Campanula poscharskyana
Jun 72
PICT00843.JPG

Photo taken by Ron or Christine Foord

82

cPICT00843indexcampanulaposcharskyanajun72foord

 

Campanula poscharskyana
08 89
PICT00842.JPG

Photo taken by Ron or Christine Foord

83

cPICT00842indexcampanulaposcharskyana0889foord

 

Campanula raineri Jul 73
PICT00845.JPG

Photo taken by Ron or Christine Foord

84

cPICT00845indexcampanularainerijul73foord

 

Campanula raineri Jul 72
PICT00847.JPG

Photo taken by Ron or Christine Foord

85

cPICT00847indexcampanularainerijul72foord

 

Campanula rupestris Jun 67
PICT00850.JPG

Photo taken by Ron or Christine Foord

86

cPICT00850indexcampanularupestrisjun67foord

 

Campanula rupestris Jun 67
PICT00849.JPG

Photo taken by Ron or Christine Foord

87

cPICT00849indexcampanularupestrisjun67foord

 

Campanula scheuchzeri
19 5 71
PICT00851.JPG

Photo taken by Ron or Christine Foord

88

cPICT00851indexcampanulascheuchzeri19571foord

 

Campanula thessala
PICT00852.JPG

Photo taken by Ron or Christine Foord

89

cPICT00852indexcampanulathessalafoord

 

Campanula thessala
PICT00853.JPG

Photo taken by Ron or Christine Foord

90

cPICT00853indexcampanulathessalafoord

 

Campanula thyrsoides Jul 73
PICT00855.JPG

Photo taken by Ron or Christine Foord

91

cPICT00855indexcampanulathyrsoidesjul73foord

 

Campanula thyrsoides Jul 73
PICT00856.JPG

Photo taken by Ron or Christine Foord

92

cPICT00856indexcampanulathyrsoidesjul73foord

 

Campanula thyrsoides Jul 75
PICT00854.JPG

Photo taken by Ron or Christine Foord

93

cPICT00854indexcampanulathyrsoidesjul75foord

 

Campanula thyrsoides Jul 73
PICT00858.JPG

Photo taken by Ron or Christine Foord

94

cPICT00858indexcampanulathyrsoidesjul73foord

 

Campanula zoysii Jul 71
PICT00861.JPG

Photo taken by Ron or Christine Foord

95

cPICT00861indexcampanulazoysiijul71foord

 

Campanula zoysii Jul 71
PICT00860.JPG

Photo taken by Ron or Christine Foord

96

cPICT00860indexcampanulazoysiijul71foord

 

 

Ivydene Gardens Plant with Photo Index Gallery:
Page C 1

Plant Name with link to its page in Ivydene Gardens:-
If this is a Rock, Wall, Paved or Water Garden Plant, then a thumbnail will be inserted in one of the 53 Flower Colour Comparison Pages in the
Rock Plant Flowers 53 Gallery. Other plants will go into their type of plant Comparison Page Gallery, like Bulb, Climber, etc.

If the image has IMG or PICT in its filename, then it is a Passthrough Camera Image of usually 4000 x 3000 pixels and it will take a long time to load on your screen. Click on it and drag it to your desktop to use it.

Type of Plant with Thumbnail

Comments
If the Image is copyrighted to
Garnons-Williams or Foord, then it is in the Public Domain and you may download it and use it. Many of the Images published within Ivydene Gardens have the copyright name appended to the Image filename.

Caragala arborescens May 65
at Kemsing
PICT00774.JPG

Photo taken by Ron or Christine Foord

97

cPICT00774indexcaragalaarborescensmay65atkemsingfoord

 

Caragala arborescens
at Kemsing May 65
PICT00862.JPG

Photo taken by Ron or Christine Foord

98

cPICT00862indexcaragalaarborescensmay65atkemsingfoord

 

Cardamine trifolia Mar 74
PICT00775.JPG

Photo taken by Ron or Christine Foord

99

cPICT00775indexcardaminetrifoliamar74foord

 

Cardiocrinum giganteum
(lilium) Jul 78
PICT00865.JPG

Photo taken by Ron or Christine Foord

100

cPICT00865indexcardiocrinumgiganteumliliumjul78foord

 

Cardiocrinum giganteum
Jul 78
PICT00869.JPG

Photo taken by Ron or Christine Foord

101

cPICT00869indexcardiocrinumgiganteumliliumjul78foord

 

Carduncellus rhaponticoides
Oct 71
PICT00829.JPG

Photo taken by Ron or Christine Foord

102

cPICT00829indexcardunculusrhaponticoidesoct71foord

 

Carduncellus rhaponticoides
Oct 71
PICT00832.JPG

Photo taken by Ron or Christine Foord

103

cPICT00832indexcardunculusrhaponticoidesoct71foord

 

Carduncellus rhaponticoides
Jun 70
PICT00837.JPG

Photo taken by Ron or Christine Foord

104

cPICT00837indexcardunculusrhaponticoidesjun70foord

 

Carduncellus rhaponticoides
Sep 70
PICT00833.JPG

Photo taken by Ron or Christine Foord

105

cPICT00833indexcardunculusrhaponticoidessep70foord

 

Carlina acaulis Aug 70
PICT00827.JPG

Photo taken by Ron or Christine Foord

106

cPICT00827indexcarlinaacaulisaug70foord

 

Carlina acaulis Aug 70
PICT00825.JPG

Photo taken by Ron or Christine Foord

107

cPICT00825indexcarlinaacaulisaug70foord

 

Catalpa bignoides in Rochester Aug 78
PICT00893.JPG

Photo taken by Ron or Christine Foord

108

cPICT00893indexcatalpabignoidesinrochesteraug78foord

 

Catalpa bignoides Sep 78
PICT00891.JPG

Photo taken by Ron or Christine Foord

109

cPICT00891indexcatalpabignoidessep78foord

 

Catalpa bignoides bloom
in Rochester, Kent Aug 78
PICT00890.JPG

Photo taken by Ron or Christine Foord

110

cPICT00890indexcatalpabignoidesbloominrochesterkentaug78foord

 

Catalpa bignoides
in Rye churchyard Sep 84
PICT00904.JPG

Photo taken by Ron or Christine Foord

111

cPICT00904indexcatalpabignoidesinryechurchyardsep84foord

 

Catalpa bignoides
in Rye churchyard Sep 84
PICT00886.JPG

Photo taken by Ron or Christine Foord

112

cPICT00886indexcatalpabignoidesinryechurchyardsep84foord

 

Catalpa bignoides tree
in Rochester, Kent -
Indian bean tree Aug 78
PICT00883.JPG

Photo taken by Ron or Christine Foord

113

cPICT00883indexcatalpabignoidestreeinrochesterkentindianbeantreeaug78foord

 

Celsio-verbascum
'Golden Wings'
PICT00909.JPG

Photo taken by Ron or Christine Foord

114

cPICT00909indexcelsioverbascumgoldenwingsfoord

 

Centaurea cyanus.
Pink
PICT00926.JPG

Photo taken by Ron or Christine Foord

115

cPICT00926indexcentaureacyanuspinkfoord

 

Centaurea montana Aug 64
PICT00924.JPG

Photo taken by Ron or Christine Foord

116

cPICT00924indexcentaureamontanaaug64foord

 

Centaurea montana 06 85
PICT00914.JPG

Photo taken by Ron or Christine Foord

117

cPICT00914indexcentaureamontana0685foord

 

Centaurea montana Jun 79
Mountain Cornflower
PICT00917.JPG

Photo taken by Ron or Christine Foord

118

cPICT00917indexcentaureamontanajun79mountaincornflowerfoord

 

Ceratostigma plumbagoides
Oct 78
PICT00927.JPG

Photo taken by Ron or Christine Foord

119

cPICT00927indexceratostigmaplumbagoidesoct78foord

 

Cerinthe alpina 15 7 64
in Einosbach Austria
PICT00929.JPG

Photo taken by Ron or Christine Foord

120

cPICT00929indexcerinthealpina15764ineinosbachaustriafoord

 

Chaenomeles japonica
31 3 65 in Borough Green
PICT00947.JPG

Photo taken by Ron or Christine Foord

121

cPICT00947indexchaenomelesjaponica31365inboroughgreenfoord

 

Chaenomeles japonica
21 4 68 Westerham
PICT00943.JPG

Photo taken by Ron or Christine Foord

122

cPICT00943indexchaenomelesjaponica21468westerhamfoord

 

Chaenomeles japonica 21 4 68
Westerham Kent
PICT00938.JPG

Photo taken by Ron or Christine Foord

123

cPICT00938indexchaenomelesjaponica21468westerhamkentfoord

 

Chaenomeles japonica May 84
PICT00945.JPG

Photo taken by Ron or Christine Foord

124

cPICT00945indexchaenomelesjaponicamay84foord

 

Chaenomeles japonica Apr 73
PICT00942.JPG

Photo taken by Ron or Christine Foord

125

cPICT00942indexchaenomelesjaponicaapr73foord

 

Chaenomeles japonica Oct 76
Quinces
PICT00932.JPG

Photo taken by Ron or Christine Foord

126

cPICT00932indexchaenomelesjaponicaoct76quincesfoord

 

Chaenomeles japonica x superba May 78
PICT00940.JPG

Photo taken by Ron or Christine Foord

127

cPICT00940indexchaenomelesjaponicaxsuperbamay78foord

 

Chaenomeles speciosa
May 85 (japonica)
PICT00934.JPG

Photo taken by Ron or Christine Foord

128

cPICT00934indexchaenomelesspeciosamay85foord

 

Chaenomeles speciosa Jun 79
PICT00931.JPG

Photo taken by Ron or Christine Foord

129

cPICT00931indexchaenomelesspeciosajun79foord

 

Chaenomeles speciosa Apr 85
PICT00930.JPG

Photo taken by Ron or Christine Foord

130

cPICT00930indexchaenomelesspeciosaapr85foord

 

Chaenomeles speciosa Apr 85
PICT00944.JPG

Photo taken by Ron or Christine Foord

131

cPICT00944indexchaenomelesspeciosaapr85foord

 

Chaenomeles x superba
Apr 85
PICT00937.JPG

Photo taken by Ron or Christine Foord

132

cPICT00937indexchaenomelesxsuperbaapr85foord

 

Cheiranthus Wallflower May 84
PICT00951.JPG

Photo taken by Ron or Christine Foord

133

cPICT00951indexcheiranthuswallflowermay84foord

 

Chionodoxa lucillae Apr 79
PICT00952.JPG

Photo taken by Ron or Christine Foord

134

cPICT00952indexchionodoxalucillaeapr79foord

 

Chionodoxa lucillae Apr 79
PICT00956.JPG

Photo taken by Ron or Christine Foord

135

cPICT00956indexchionodoxalucillaeapr79foord

 

Chionodoxa sardensis May 84
PICT00957.JPG

Photo taken by Ron or Christine Foord

136

cPICT00957indexchionodoxasardensismay84foord

 

Chlorophytum comosum
Jun 69 Spider Plant
PICT00959.JPG

Photo taken by Ron or Christine Foord

137

cPICT00959indexchlorophytumcomosumjun69spiderplantfoord

 

Chlorophytum elatum variegatum
07 88 Spider Plant
PICT00961.JPG

Photo taken by Ron or Christine Foord

138

cPICT00961indexchlorophytumelatumvariegatum0788spiderplantfoord

 

Choisya ternata May 85
Mexican Orange blossom
PICT00966.JPG

Photo taken by Ron or Christine Foord

139

cPICT00966indexchoisyaternatamay85mexicanorangeblossomfoord

 

Choisya ternata May 85
Mexican Orange blossom
PICT00971.JPG

Photo taken by Ron or Christine Foord

140

cPICT00971indexchoisyaternatamay85mexicanorangeblossomfoord

 

Choisya ternata Jun 83
Mexican Orange blossom
PICT00970.JPG

Photo taken by Ron or Christine Foord

141

cPICT00970indexchoisyaternatajun83mexicanorangeblossomfoord

 

Choisya ternata Jun 79
Mexican Orange
PICT00964.JPG

Photo taken by Ron or Christine Foord

142 ***

cPICT00964indexchoisyaternatajun79mexicanorangefoord

 

Chrysanthemum 'Golden Orfe' Oct 78
PICT00975.JPG

Photo taken by Ron or Christine Foord

143

cPICT00975indexchrysanthemumgoldenorfeoct78foord

 

Chrysanthemum 'Golden Orfe' Oct 78
PICT00976.JPG

Photo taken by Ron or Christine Foord

144

cPICT00976indexchrysanthemumgoldenorfeoct78foord

 

Chrysanthemum maximum
Aug 72
Shasta Daisy Mayfield Giant
PICT00980.JPG

Photo taken by Ron or Christine Foord

145

cPICT00980indexchrysanthemummaximumaug72shastadaisymayfieldgiantfoord

 

Chusquea couleou
Shoots on bamboo first year canes Oct 78
PICT00973.JPG

Photo taken by Ron or Christine Foord

146

cPICT00973indexchusqueacouleoushootsonbamboofirstyearcanesoct78foord

 

Chusquea couleou
Shoots on bamboo first year canes Oct 78
PICT00974.JPG

Photo taken by Ron or Christine Foord

147

cPICT00974indexchusqueacouleoushootsonbamboofirstyearcanesoct78foord

 

Chusquea couleou Sep 78
Bamboo
PICT00972.JPG

Photo taken by Ron or Christine Foord

148

cPICT00972indexchusqueacouleousep78bambooyearfoord

 

Cirsium spinosissimum 12 7 64
Spiniest thistle on Hoher Jpen
PICT01003.JPG

Photo taken by Ron or Christine Foord

149

cPICT01003indexcirsiumspinosissimum12764spiniestthistleonhoherjpenfoord

 

Cistus ladaniferus Jul 84
PICT01013.JPG

Photo taken by Ron or Christine Foord

150

cPICT01013indexcistusladaniferusjul84foord

 

Cistus ladaniferus Aug 79
Gum cistus
PICT01017.JPG

Photo taken by Ron or Christine Foord

151

cPICT01017indexcistusladaniferusaug79gumcistusfoord

 

Cistus ladaniferus Jul 79
Gum cistus
PICT01018.JPG

Photo taken by Ron or Christine Foord

152

cPICT01018indexcistusladaniferusjul79gumcistusfoord

 

Cistus ladaniferus 07 85
PICT01005.JPG

Photo taken by Ron or Christine Foord

153

cPICT01005indexcistusladaniferus0785foord

 

Cistus purpureus 06 85
PICT01028.JPG

Photo taken by Ron or Christine Foord

154

cistuspurpureus0685PICT01028

 

Cistus purpureus
PICT01023.JPG

Photo taken by Ron or Christine Foord

155

cistuspurpureusPICT01023

 

Cistus purpureus Jun 82
PICT01025.JPG

Photo taken by Ron or Christine Foord

156

cistuspurpureusjun82PICT01025

 

Cistus 'Sunset' Jul 71
PICT01031.JPG

Photo taken by Ron or Christine Foord

157

cistussunsetjul71PICT01031

 

Cistus 'Sunset' Jul 73
PICT01033.JPG

Photo taken by Ron or Christine Foord

158

cistussunsetjul73PICT01033

 

Cistus 'Sunset' Jul 73
PICT01034.JPG

Photo taken by Ron or Christine Foord

159

cistussunsetjul73PICT01034

 

Clematis lasurstern Jul 78
PICT01037.JPG

Photo taken by Ron or Christine Foord

160

clematislasursternjul78PICT01037

 

Clematis lasurstern Jul 84
PICT01040.JPG

Photo taken by Ron or Christine Foord

161

clematislasursternjul84PICT01040

 

Clematis lasurstern 07 85
PICT01039.JPG

Photo taken by Ron or Christine Foord

162

clematislasurstern0785PICT01039

 

Clematis macropetalla May 73
PICT01047.JPG

Photo taken by Ron or Christine Foord

163

clematismacropetallamay73PICT01047

 

Clematis macropetalla May 70
at Wisley
PICT01041.JPG

Photo taken by Ron or Christine Foord

164

clematismacropetallamay70wisleyPICT01041

 

Clematis montana Jun 84
PICT01052.JPG

Photo taken by Ron or Christine Foord

165

cPICT01052indexclematismontanajun84foord

 

Clematis montana 06 85
PICT01053.JPG

Photo taken by Ron or Christine Foord

166

cPICT01053indexclematismontana0685foord

 

Clematis montana May 85
PICT01045.JPG

Photo taken by Ron or Christine Foord

167

cPICT01045indexclematismontanamay85foord

 

Clematis montana 'Alba' May 73
PICT01048.JPG

Photo taken by Ron or Christine Foord

168

cPICT01048indexclematismontanaalbamay73foord

 

Clematis montana 'Alba' May 73
at Wells in Somerset
PICT01054.JPG

Photo taken by Ron or Christine Foord

169

cPICT01054indexclematismontanaalbamay73atwellsinsomersetfoord

 

Clematis montana 'Alba' Jun 72
in Norfolk
PICT01051.JPG

Photo taken by Ron or Christine Foord

170

cPICT01051indexclematismontanaalbajun72innorfolkfoord

 

Clematis 'Nellie Mosa' at Hythe
Jun 73
PICT01057.JPG

Photo taken by Ron or Christine Foord

171

cPICT01057indexclematisnelliemosaathythefoord

 

Clematis 'Nellie Mosa' at Hythe
Jun 73
PICT01058.JPG

Photo taken by Ron or Christine Foord

172

cPICT01058indexclematisnelliemosajun73athythefoord

 

Clematis 'Nellie Mosa' at Hythe
Jun 73
PICT01056.JPG

Photo taken by Ron or Christine Foord

173

cPICT01056indexclematisnelliemosajun73athythefoord

 

Clematis viticella minuet Oct 78
PICT01067.JPG

Photo taken by Ron or Christine Foord

174

cPICT01067indexclematisviticellaminuetoct78foord

 

Clintonia alsinoides 23 5 70 at Wisley
PICT01036.JPG

Photo taken by Ron or Christine Foord

175

cPICT01036indexclintoniaalsinoides23570atwisleyfoord

 

Clematis tangutica Aug 72
PICT01063.JPG

Photo taken by Ron or Christine Foord

176

cPICT01063indexclematistanguticaaug72foord

 

Clematis tangutica Aug 72
PICT01064.JPG

Photo taken by Ron or Christine Foord

177

cPICT01064indexclematistanguticaaug72foord

 

Clematis tangutica
PICT01060.JPG

Photo taken by Ron or Christine Foord

178

cPICT01060indexclematistanguticafoord

 

Clianthus dampieri May 76
Sturts desert pea
PICT00999.JPG

Photo taken by Ron or Christine Foord

179

cPICT00999indexclianthusdampierimay76sturtsdesertpeafoord

 

Clianthus dampieri 13 6 62
Sturts desert pea at Kew
in the Pea family
from Australia
PICT00992.JPG

Photo taken by Ron or Christine Foord

180

cPICT00992indexclianthusdampieri13662sturtsdesertpeaatkewinthepeafamilyfromaustraliafoord

 

Clianthus dampieri Jun 76
Sturts desert pea
PICT00993.JPG

Photo taken by Ron or Christine Foord

181

cPICT00993indexclianthusdampierijun76sturtsdesertpeafoord

 

Clianthus dampieri Oct 76
Sturts desert pea
PICT00997.JPG

Photo taken by Ron or Christine Foord

182

cPICT00997indexclianthusdampierioct76sturtsdesertpeafoord

 

Clianthus dampieri
growing in our -
Ron and Christine Foord's -
greenhouse Sep 76
PICT00989.JPG

Photo taken by Ron or Christine Foord

183

cPICT00989indexclianthusdampierigrowinginourgreenhousesep76foord

 

Clura muniata garden form
(amaryllidacea) in Kew Mar 65
PICT01068.JPG

Photo taken by Ron or Christine Foord

184

cPICT01068indexcluramuniatagardenforminkewmar65foord

 

Cobaea scandens 8 10 64
at Borough Green
PICT01069.JPG

Photo taken by Ron or Christine Foord

185

cPICT01069indexcobaeascandens81064atboroughgreenfoord

 

Cobaea scandens 8 10 64
at Borough Green
PICT01071.JPG

Photo taken by Ron or Christine Foord

186

cPICT01071indexcobaeascandens81064atboroughgreenfoord

 

Cobaea scandens flora alba Oct 78
PICT01077.JPG

Photo taken by Ron or Christine Foord

187

cPICT01077indexcobaeascandensfloraalbaoct78foord

 

Cobaea scandens flora alba
Oct 78
at Sissinghurst Castle Garden
PICT01073.JPG

Photo taken by Ron or Christine Foord

188

cPICT01073indexcobaeascandensfloraalbaoct78atsissinghurstcastlegardenfoord

 

Codonopsis clematidea
PICT01083.JPG

Photo taken by Ron or Christine Foord

189

cPICT01083indexcodonopsisclematideafoord

 

Codonopsis clematidea Jul 70
PICT01078.JPG

Photo taken by Ron or Christine Foord

190

cPICT01078indexcodonopsisclematideajul70foord

 

Codonopsis clematidea Jul 73
PICT01095.JPG

Photo taken by Ron or Christine Foord

191

cPICT01095indexcodonopsisclematideajul73foord

 

Codonopsis clematidea Aug 70
PICT01086.JPG

Photo taken by Ron or Christine Foord

192

cPICT01086indexcodonopsisclematideaaug70foord

 

Codonopsis clematidea Jul 71
PICT01089.JPG

Photo taken by Ron or Christine Foord

193

cPICT01089indexcodonopsisclematideajul71foord

 

Colchicum luteum Apr 70
PICT01105.JPG

Photo taken by Ron or Christine Foord

194

cPICT01105indexcolchicumluteumapr70foord

 

Topic
Plants detailed in this website by
Botanical Name

A, B, C, D, E, F, G,
H, I, J, K, L, M, N,
O, P, Q, R, S, T, U,
V, W, X, Y, Z ,
Bulb
A1
, 2, 3, B, C1, 2,
D, E, F, G, Glad,
H, I, J, K, L1, 2,
M, N, O, P, Q, R,
S, T, U, V, W, XYZ ,
Evergreen Perennial
A
, B, C, D, E, F, G,
H, I, J, K, L, M, N,
O, P, Q, R, S, T, U,
V, W, X, Y, Z ,
Herbaceous Perennial
A1
, 2, B, C, D, E, F,
G, H, I, J, K, L, M,
N, O, P1, 2, Q, R,
S, T, U, V, W, XYZ,
Diascia Photo Album,
UK Peony Index

Wildflower
Botanical Names,
Common Names ,

will be
compared in:- Flower colour/month
Evergreen Perennial
,
F
lower shape Wildflower Flower Shape and
Plant use
Evergreen Perennial Flower Shape,
Bee plants for hay-fever sufferers

Bee-Pollinated Index
Butterfly
Egg, Caterpillar, Chrysalis, Butterfly Usage
of Plants.
Chalk
A, B, C, D, E, F, G,
H, I, J, K, L, M, N,
O, P, QR, S, T, UV,
WXYZ
Companion Planting
A, B, C, D, E, F, G,
H, I, J, K, L, M, N,
O, P, Q, R , S, T,
U ,V, W, X, Y, Z,
Pest Control using Plants
Fern Fern
1000 Ground Cover A, B, C, D, E, F, G,
H, I, J, K, L, M, N,
O, P, Q, R, S, T, U,
V, W, XYZ ,
Rock Garden and Alpine Flowers
A, B, C, D, E, F, G,
H, I, J, K, L, M,
NO, PQ, R, S, T,
UVWXYZ

Rose Rose Use

These 5 have Page links in rows below
Bulbs from the Infill Galleries (next row), Camera Photos,
Plant Colour Wheel Uses,
Sense of Fragrance, Wild Flower


Case Studies
...Drive Foundations
Ryegrass and turf kills plants within Roadstone and in Topsoil due to it starving and dehydrating them.
CEDAdrive creates stable drive surface and drains rain into your ground, rather than onto the public road.
8 problems caused by building house on clay or with house-wall attached to clay.
Pre-building work on polluted soil.

Companion Planting
to provide a Companion Plant to aid your selected plant or deter its pests

Garden
Construction

with ground drains

Garden Design
...How to Use the Colour Wheel Concepts for Selection of Flowers, Foliage and Flower Shape
...RHS Mixed
Borders

......Bedding Plants
......Her Perennials
......Other Plants
......Camera photos of Plant supports
Garden
Maintenance

Glossary with a tomato teaching cauliflowers
Home
Library of over 1000 books
Offbeat Glossary with DuLally Bird in its flower clock.

Plants
...in Chalk
(Alkaline) Soil
......A-F1, A-F2,
......A-F3, G-L, M-R,
......M-R Roses, S-Z
...in Heavy
Clay Soil
......A-F, G-L, M-R,
......S-Z
...in Lime-Free
(Acid) Soil
......A-F, G-L, M-R,
......S-Z
...in Light
Sand Soil
......A-F, G-L, M-R,
......S-Z.
...Poisonous Plants.
...Extra Plant Pages
with its 6 Plant Selection Levels

Soil
...
Interaction between 2 Quartz Sand Grains to make soil
...
How roots of plants are in control in the soil
...
Without replacing Soil Nutrients, the soil will break up to only clay, sand or silt
...
Subsidence caused by water in Clay
...
Use water ring for trees/shrubs for first 2 years.

Tool Shed with 3 kneeling pads
Useful Data with benefits of Seaweed

Topic -
Plant Photo Galleries
If the plant type below has flowers, then the first gallery will include the flower thumbnail in each month of 1 of 6 colour comparison pages of each plant in its subsidiary galleries, as a low-level Plant Selection Process

Aquatic
Bamboo
Bedding
...by Flower Shape

Bulb
...Allium/ Anemone
...Autumn
...Colchicum/ Crocus
...Dahlia
...Gladiolus with its 40 Flower Colours
......European A-E
......European F-M
......European N-Z
......European Non-classified
......American A,
B, C, D, E, F, G,
H, I, J, K, L, M,
N, O, P, Q, R, S,
T, U, V, W, XYZ
......American Non-classified
......Australia - empty
......India
......Lithuania
...Hippeastrum/ Lily
...Late Summer
...Narcissus
...Spring
...Tulip
...Winter
...Each of the above ...Bulb Galleries has its own set of Flower Colour Pages
...Flower Shape
...Bulb Form

...Bulb Use

...Bulb in Soil


Further details on bulbs from the Infill Galleries:-
Hardy Bulbs
...Aconitum
...Allium
...Alstroemeria
...Anemone

...Amaryllis
...Anthericum
...Antholyzas
...Apios
...Arisaema
...Arum
...Asphodeline

...Asphodelus
...Belamcanda
...Bloomeria
...Brodiaea
...Bulbocodium

...Calochorti
...Cyclobothrias
...Camassia
...Colchicum
...Convallaria 
...Forcing Lily of the Valley
...Corydalis
...Crinum
...Crosmia
...Montbretia
...Crocus

...Cyclamen
...Dicentra
...Dierama
...Eranthis
...Eremurus
...Erythrnium
...Eucomis

...Fritillaria
...Funkia
...Galanthus
...Galtonia
...Gladiolus
...Hemerocallis

...Hyacinth
...Hyacinths in Pots
...Scilla
...Puschkinia
...Chionodoxa
...Chionoscilla
...Muscari

...Iris
...Kniphofia
...Lapeyrousia
...Leucojum

...Lilium
...Lilium in Pots
...Malvastrum
...Merendera
...Milla
...Narcissus
...Narcissi in Pots

...Ornithogalum
...Oxalis
...Paeonia
...Ranunculus
...Romulea
...Sanguinaria
...Sternbergia
...Schizostylis
...Tecophilaea
...Trillium

...Tulip
...Zephyranthus

Half-Hardy Bulbs
...Acidanthera
...Albuca
...Alstroemeri
...Andro-stephium
...Bassers
...Boussing-aultias
...Bravoas
...Cypellas
...Dahlias
...Galaxis,
...Geissorhizas
...Hesperanthas

...Gladioli
...Ixias
...Sparaxises
...Babianas
...Morphixias
...Tritonias

...Ixiolirions
...Moraeas
...Ornithogalums
...Oxalises
...Phaedra-nassas
...Pancratiums
...Tigridias
...Zephyranthes
...Cooperias

Uses of Bulbs:-
...for Bedding
...in Windowboxes
...in Border
...naturalized in Grass
...in Bulb Frame
...in Woodland Garden
...in Rock Garden
...in Bowls
...in Alpine House
...Bulbs in Green-house or Stove:-
...Achimenes
...Alocasias
...Amorpho-phalluses
...Arisaemas
...Arums
...Begonias
...Bomareas
...Caladiums

...Clivias
...Colocasias
...Crinums
...Cyclamens
...Cyrtanthuses
...Eucharises
...Urceocharis
...Eurycles

...Freesias
...Gloxinias
...Haemanthus
...Hippeastrums

...Lachenalias
...Nerines
...Lycorises
...Pencratiums
...Hymenocallises
...Richardias
...Sprekelias
...Tuberoses
...Vallotas
...Watsonias
...Zephyranthes

...Plant Bedding in
......Spring

......Summer
...Bulb houseplants flowering during:-
......January
......February
......March
......April
......May
......June
......July
......August
......September
......October
......November
......December
...Bulbs and other types of plant flowering during:-
......Dec-Jan
......Feb-Mar
......Apr-May
......Jun-Aug
......Sep-Oct
......Nov-Dec
...Selection of the smaller and choicer plants for the Smallest of Gardens with plant flowering during the same 6 periods as in the previous selection

Climber in
3 Sector Vertical Plant System
...Clematis
...Climbers
Conifer
Deciduous Shrub
...Shrubs - Decid
Deciduous Tree
...Trees - Decid
Evergreen Perennial
...P-Evergreen A-L
...P-Evergreen M-Z
...Flower Shape
Evergreen Shrub
...Shrubs - Evergreen
...Heather Shrub
...Heather Index
......Andromeda
......Bruckenthalia
......Calluna
......Daboecia
......Erica: Carnea
......Erica: Cinerea
......Erica: Others
Evergreen Tree
...Trees - Evergreen
Fern
Grass
Hedging
Herbaceous
Perennial

...P -Herbaceous
...Peony
...Flower Shape
...RHS Wisley
......Mixed Border
......Other Borders
Herb
Odds and Sods
Rhododendron

Rose
...RHS Wisley A-F
...RHS Wisley G-R
...RHS Wisley S-Z
...Rose Use - page links in row 6. Rose, RHS Wisley and Other Roses rose indices on each Rose Use page
...Other Roses A-F
...Other Roses G-R
...Other Roses S-Z
Pruning Methods
Photo Index
R 1, 2, 3
Peter Beales Roses
RV Roger
Roses

Soft Fruit
Top Fruit
...Apple

...Cherry
...Pear
Vegetable
Wild Flower and
Butterfly page links are in next row

Topic -
UK Butterfly:-
...Egg, Caterpillar, Chrysalis and Butterfly Usage
of Plants.
...Plant Usage by
Egg, Caterpillar, Chrysalis and Butterfly.

Both native wildflowers and cultivated plants, with these
...Flower Shape,
...
Uses in USA,
...
Uses in UK and
...
Flo Cols / month are used by Butter-flies native in UK


Wild Flower
with its wildflower flower colour page, space,
data page(s).
...Blue Site Map.
Scented Flower, Foliage, Root.
Story of their Common Names.
Use of Plant with Flowers.
Use for Non-Flowering Plants.
Edible Plant Parts.
Flower Legend.
Flowering plants of
Chalk and
Limestone 1
, 2.
Flowering plants of Acid Soil
1.
...Brown Botanical Names.
Food for
Butterfly/Moth.

...Cream Common Names.
Coastal and Dunes.
Sandy Shores and Dunes.
...Green Broad-leaved Woods.
...Mauve Grassland - Acid, Neutral, Chalk.
...Multi-Cols Heaths and Moors.
...Orange Hedge-rows and Verges.
...Pink A-G Lakes, Canals and Rivers.
...Pink H-Z Marshes, Fens, Bogs.
...Purple Old Buildings and Walls.
...Red Pinewoods.
...White A-D
Saltmarshes.
Shingle Beaches, Rocks and Cliff Tops.
...White E-P Other.
...White Q-Z Number of Petals.
...Yellow A-G
Pollinator.
...Yellow H-Z
Poisonous Parts.
...Shrub/Tree River Banks and other Freshwater Margins. and together with cultivated plants in
Colour Wheel.

You know its
name:-
a-h, i-p, q-z,
Botanical Names, or Common Names,
habitat:-
on
Acid Soil,
on
Calcareous
(Chalk) Soil
,
on
Marine Soil,
on
Neutral Soil,
is a
Fern,
is a
Grass,
is a
Rush,
is a
Sedge, or
is
Poisonous.

Each plant in each WILD FLOWER FAMILY PAGE will have a link to:-
1) its created Plant Description Page in its Common Name column, then external sites:-
2) to purchase the plant or seed in its Botanical Name column,
3) to see photos in its Flowering Months column and
4) to read habitat details in its Habitat Column.
Adder's Tongue
Amaranth
Arrow-Grass
Arum
Balsam
Bamboo
Barberry
Bedstraw
Beech
Bellflower
Bindweed
Birch
Birds-Nest
Birthwort
Bogbean
Bog Myrtle
Borage
Box
Broomrape
Buckthorn
Buddleia
Bur-reed
Buttercup
Butterwort
Cornel (Dogwood)
Crowberry
Crucifer (Cabbage/Mustard) 1
Crucifer (Cabbage/Mustard) 2
Cypress
Daffodil
Daisy
Daisy Cudweeds
Daisy Chamomiles
Daisy Thistle
Daisy Catsears Daisy Hawkweeds
Daisy Hawksbeards
Daphne
Diapensia
Dock Bistorts
Dock Sorrels
Clubmoss
Duckweed
Eel-Grass
Elm
Filmy Fern
Horsetail
Polypody
Quillwort
Royal Fern
Figwort - Mulleins
Figwort - Speedwells
Flax
Flowering-Rush
Frog-bit
Fumitory
Gentian
Geranium
Glassworts
Gooseberry
Goosefoot
Grass 1
Grass 2
Grass 3
Grass Soft
Bromes 1

Grass Soft
Bromes 2

Grass Soft
Bromes 3

Hazel
Heath
Hemp
Herb-Paris
Holly
Honeysuckle
Horned-Pondweed
Hornwort
Iris
Ivy
Jacobs Ladder
Lily
Lily Garlic
Lime
Lobelia
Loosestrife
Mallow
Maple
Mares-tail
Marsh Pennywort
Melon (Gourd/Cucumber)
Mesem-bryanthemum
Mignonette
Milkwort
Mistletoe
Moschatel
Naiad
Nettle
Nightshade
Oleaster
Olive
Orchid 1
Orchid 2
Orchid 3
Orchid 4
Parnassus-Grass
Peaflower
Peaflower
Clover 1

Peaflower
Clover 2

Peaflower
Clover 3

Peaflower Vetches/Peas
Peony
Periwinkle
Pillwort
Pine
Pink 1
Pink 2
Pipewort
Pitcher-Plant
Plantain
Pondweed
Poppy
Primrose
Purslane
Rannock Rush
Reedmace
Rockrose
Rose 1
Rose 2
Rose 3
Rose 4
Rush
Rush Woodrushes
Saint Johns Wort
Saltmarsh Grasses
Sandalwood
Saxifrage
Seaheath
Sea Lavender
Sedge Rush-like
Sedges Carex 1
Sedges Carex 2
Sedges Carex 3
Sedges Carex 4
Spindle-Tree
Spurge
Stonecrop
Sundew
Tamarisk
Tassel Pondweed
Teasel
Thyme 1
Thyme 2
Umbellifer 1
Umbellifer 2
Valerian
Verbena
Violet
Water Fern
Waterlily
Water Milfoil
Water Plantain
Water Starwort
Waterwort
Willow
Willow-Herb
Wintergreen
Wood-Sorrel
Yam
Yew


Topic -
The following is a complete hierarchical Plant Selection Process

dependent on the Garden Style chosen
Garden Style
...Infill Plants
...12 Bloom Colours per Month Index
...12 Foliage Colours per Month Index
...All Plants Index
...Cultivation, Position, Use Index
...Shape, Form
Index

 


Topic -
Flower/Foliage Colour Wheel Galleries with number of colours as a high-level Plant Selection Process

All Flowers 53 with
...Use of Plant and
Flower Shape
- page links in bottom row

All Foliage 53
instead of redundant
...(All Foliage 212)


All Flowers
per Month 12


Bee instead of wind pollinated plants for hay-fever sufferers
All Bee-Pollinated Flowers
per Month
12
...Index

Rock Garden and Alpine Flowers
Rock Plant Flowers 53
INDEX
A, B, C, D, E, F,
G, H, I, J, K, L,
M, NO, PQ, R, S,
T, UVWXYZ
...Rock Plant Photos

Flower Colour Wheel without photos, but with links to photos
12 Bloom Colours
per Month Index

...All Plants Index


Topic -
Use of Plant in your Plant Selection Process

Plant Colour Wheel Uses
with
1. Perfect general use soil is composed of 8.3% lime, 16.6% humus, 25% clay and 50% sand, and
2. Why you are continually losing the SOIL STRUCTURE so your soil - will revert to clay, chalk, sand or silt.
Uses of Plant and Flower Shape:-
...Foliage Only
...Other than Green Foliage
...Trees in Lawn
...Trees in Small Gardens
...Wildflower Garden
...Attract Bird
...Attract Butterfly
1
, 2
...Climber on House Wall
...Climber not on House Wall
...Climber in Tree
...Rabbit-Resistant
...Woodland
...Pollution Barrier
...Part Shade
...Full Shade
...Single Flower provides Pollen for Bees
1
, 2, 3
...Ground-Cover
<60
cm
60-180cm
>180cm
...Hedge
...Wind-swept
...Covering Banks
...Patio Pot
...Edging Borders
...Back of Border
...Poisonous
...Adjacent to Water
...Bog Garden
...Tolerant of Poor Soil
...Winter-Flowering
...Fragrant
...Not Fragrant
...Exhibition
...Standard Plant is 'Ball on Stick'
...Upright Branches or Sword-shaped leaves
...Plant to Prevent Entry to Human or Animal
...Coastal Conditions
...Tolerant on North-facing Wall
...Cut Flower
...Potted Veg Outdoors
...Potted Veg Indoors
...Thornless
...Raised Bed Outdoors Veg
...Grow in Alkaline Soil A-F, G-L, M-R,
S-Z
...Grow in Acidic Soil
...Grow in Any Soil
...Grow in Rock Garden
...Grow Bulbs Indoors

Uses of Bedding
...Bedding Out
...Filling In
...Screen-ing
...Pots and Troughs
...Window Boxes
...Hanging Baskets
...Spring Bedding
...Summer Bedding
...Winter Bedding
...Foliage instead of Flower
...Coleus Bedding Photos for use in Public Domain 1

Uses of Bulb
...Other than Only Green Foliage
...Bedding or Mass Planting
...Ground-Cover
...Cut-Flower
...Tolerant of Shade
...In Woodland Areas
...Under-plant
...Tolerant of Poor Soil
...Covering Banks
...In Water
...Beside Stream or Water Garden
...Coastal Conditions
...Edging Borders
...Back of Border or Back-ground Plant
...Fragrant Flowers
...Not Fragrant Flowers
...Indoor
House-plant

...Grow in a Patio Pot
...Grow in an Alpine Trough
...Grow in an Alpine House
...Grow in Rock Garden
...Speciman Plant
...Into Native Plant Garden
...Naturalize in Grass
...Grow in Hanging Basket
...Grow in Window-box
...Grow in Green-house
...Grow in Scree
...Naturalized Plant Area
...Grow in Cottage Garden
...Attracts Butterflies
...Attracts Bees
...Resistant to Wildlife
...Bulb in Soil:-
......Chalk
......Clay
......Sand
......Lime-Free (Acid)
......Peat

Uses of Rose
Rose Index

...Bedding 1, 2
...Climber /Pillar
...Cut-Flower 1, 2
...Exhibition, Speciman
...Ground-Cover
...Grow In A Container 1, 2
...Hedge 1, 2
...Climber in Tree
...Woodland
...Edging Borders
...Tolerant of Poor Soil 1, 2
...Tolerant of Shade
...Back of Border
...Adjacent to Water
...Page for rose use as ARCH ROSE, PERGOLA ROSE, COASTAL CONDITIONS ROSE, WALL ROSE, STANDARD ROSE, COVERING BANKS or THORNLESS ROSES.
...FRAGRANT ROSES
...NOT FRAGRANT ROSES


Topic -
Camera Photo Galleries showing all 4000 x 3000 pixels of each photo on your screen that you can then click and drag it to your desktop:-

RHS Garden at Wisley

Plant Supports -
When supporting plants in a bed, it is found that not only do those plants grow upwards, but also they expand their roots and footpad sideways each year. Pages
1
, 2, 3, 8, 11,
12, 13,
Plants 4, 7, 10,
Bedding Plants 5,
Plant Supports for Unknown Plants 5
,
Clematis Climbers 6,
the RHS does not appear to either follow it's own pruning advice or advice from The Pruning of Trees, Shrubs and Conifers by George E. Brown.
ISBN 0-571-11084-3 with the plants in Pages 1-7 of this folder. You can see from looking at both these resources as to whether the pruning carried out on the remainder of the plants in Pages 7-15 was correct.

Narcissus (Daffodil) 9,
Phlox Plant Supports 14, 15

Coleus Bedding Foliage Trial - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13, 14, 15,
16, 17, 18, 19, 20,
21, 22, 23, 24, 25,
26, 27, 28, 29, 30,
31, 32, Index

National Trust Garden at Sissinghurst Castle
Plant Supports -
Pages for Gallery 1

with Plant Supports
1, 5, 10
Plants
2, 3, 4, 6, 7, 8, 9,
11, 12
Recommended Rose Pruning Methods 13
Pages for Gallery 2
with Plant Supports
2
,
Plants 1, 3, 4, 5, 6, 7

Dry Garden of
RHS Garden at
Hyde Hall

Plants - Pages
without Plant Supports
Plants 1
, 2, 3, 4, 5, 6, 7, 8, 9

Nursery of
Peter Beales Roses
Display Garden

Roses Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13

Nursery of
RV Roger

Roses - Pages
A1,A2,A3,A4,A5,
A6,A7,A8,A9,A10,
A11,A12,A13,A14,
B15,
B16,B17,B18,B19,
B20,
B21,B22,B23,B24,
B25,
B26,B27,B28,B29,
B30,
C31,C32,C33,C34,
C35,
C36,C37,C38,C39,
C40,
C41,CD2,D43,D44,
D45,
D46,D47,D48,D49,
E50,
E51,E52,F53,F54,
F55,
F56,F57,G58,G59,
H60,
H61,I62,K63,L64,
M65,
M66,N67,P68,P69,
P70,
R71,R72,S73,S74,
T75,
V76,Z77, 78,

Damage by Plants in Chilham Village - Pages
1, 2, 3, 4

Pavements of Funchal, Madeira
Damage to Trees - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13
for trees 1-54,
14, 15,
16, 17, 18, 19, 20,
21, 22, 23, 24, 25,
for trees 55-95,
26, 27, 28, 29, 30,
31, 32, 33, 34, 35,
36, 37,
for trees 95-133,
38, 39, 40,
41, 42, 43, 44, 45,
for trees 133-166

Chris Garnons-Williams
Work Done - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13

Identity of Plants
Label Problems - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11

Ron and Christine Foord - 1036 photos only inserted so far - Garden Flowers - Start Page of each Gallery
AB1 ,AN14,BA27,
CH40,CR52,DR63,
FR74,GE85,HE96,

Plant with Photo Index of Ivydene Gardens - 1187
A 1, 2, Photos - 43
B 1, Photos - 13
C 1, Photos - 35
D 1, 2, 3, 4, 5, 6, 7,
Photos - 411
with Plants causing damage to buildings in Chilham Village and Damage to Trees in Pavements of Funchal
E 1, Photos - 21
F 1, Photos - 1
G 1, Photos - 5
H 1, Photos - 21
I 1, Photos - 8
J 1, Photos - 1
K 1, Photos - 1
L 1, Photos - 85
with Label Problems
M 1, Photos - 9
N 1, Photos - 12
O 1, Photos - 5
P 1, Photos - 54
Q 1, Photos -
R 1, 2, 3,
Photos - 229
S 1, Photos - 111
T 1, Photos - 13
U 1, Photos - 5
V 1, Photos - 4
W 1, Photos - 100
with Work Done by Chris Garnons-Williams
X 1 Photos -
Y 1, Photos -
Z 1 Photos -
Articles/Items in Ivydene Gardens - 88
Flower Colour, Num of Petals, Shape and
Plant Use of:-
Rock Garden
within linked page


 

 

Topic -
Fragrant Plants:-

Sense of Fragrance from Roy Genders

Fragrant Plants:-
Trees and Shrubs with Scented Flowers
1
, 2, 3, 4, 5, 6
Shrubs bearing Scented Flowers for an Acid Soil
1
, 2, 3, 4
Shrubs bearing Scented Flowers for a
Chalky or Limestone Soil
1
, 2, 3, 4
Shrubs bearing Scented leaves for a
Sandy Soil
1
, 2, 3
Herbaceous Plants with Scented Flowers
1
, 2, 3
Annual and Biennial Plants with Scented Flowers or Leaves
1
, 2
Bulbs and Corms with Scented Flowers
1
, 2, 3, 4, 5
Scented Plants of Climbing and Trailing Habit
1
, 2, 3
Winter-flowering Plants with Scented Flowers
1
, 2
Night-scented Flowering Plants
1
, 2
 


Topic -
Website User Guidelines


My Gas Service Engineer found Flow and Return pipes incorrectly positioned on gas boilers and customers had refused to have positioning corrected in 2020.
 

PLANT WITH PHOTO INDEX GALLERY PAGES

The plant with photo in the Camera Photo Galleries in the next column
join

the plants with photos in the other Plant Photo Galleries as shown in the last column in

Plant with Photo Index of Ivydene Gardens - 1187
A 1, 2, Photos - 43
B 1, Photos - 13
C 1, 2, Photos - 35
D 1, 2, 3, 4, 5, 6, 7,
Photos - 411

Photos of
Plants causing damage to buildings in Chilham Village and
Photos of
Damage to Trees in Pavements of Funchal
are also in the D pages
E 1, Photos - 21
F 1, Photos - 1
G 1, Photos - 5
H 1, Photos - 21
I 1, Photos - 8
J 1, Photos - 1
K 1, Photos - 1
L 1, Photos - 85
Photos of
Label Problems are also in the L pages
M 1, Photos - 9
N 1, Photos - 12
O 1, Photos - 5
P 1, Photos - 54
Q 1, Photos -
R 1,R 2,R 3,
Photos - 229
S 1, Photos - 111
T 1, Photos - 13
U 1, Photos - 5
V 1, Photos - 4
W 1, Photos - 100
Photos of
Work Done by Chris
Garnons-Williams are also in the W pages

X 1 Photos -
Y 1, Photos -
Z 1 Photos -

Articles/Items in Ivydene Gardens - 88

Flower Colour, Number of Petals, Shape and
Plant Use of:-

Rock Garden
...within linked page


 

 

Number of Colours required to provide a practical means of roughly differentiating between flower colours, foliage colours and bark/stem colours of plants.

Flower Colour:-
These are the 14 Flower Colours for the UK Native Wildflowers:-
Wild Flower with its
flower colour page, space,
Site Map page in its flower colour
NOTE Gallery
...Blue Note
...Brown Note
...Cream Note
...Green Note
...Mauve Note
...Multi-Cols Note
...Orange Note
...Pink A-G Note
...Pink H-Z Note
...Purple Note
...Red Note
...White A-D Note
...White E-P Note
...White Q-Z Note
...Yellow A-G Note
...Yellow H-Z Note
...Shrub/Tree Note

There are 53 flower colours for All Flowers Colour Wheel and Rock Plant Flowers:-
Dark Tone or Shades (Colours mixed with Black) is the outer circle of colours.
Mid-Tone (Colours mixed with Grey) is the next circle of colours.
Pure Hue (the Primary, Secondary or Tertiary Colour named) is the next circle of colours.
Pastel (Colours mixed with White) is the innermost circle of colours.

These 12 colour spokes of
Dark Tone,
Mid-Tone,
Pure Hue and
Pastel are split into:-

Number

Primary Colour Name

Pure Hue Colour Name Used

1

Red

Red

2

Yellow

Yellow

3

Blue

Blue

Number

Secondary Colour Name

Pure Hue Colour Name Used

10

Orange

Vitamin C

11

Green

Lime

12

Violet

Magenta

Number

Tertiary Colour Name

Pure Hue Colour Name Used

100

Red Orange

Orange

101

Yellow Orange

Tangerine

102

Yellow Green

Lovely Lime

103

Blue Green

Light Teal

104

Blue Violet

Grape

 

Dark tone, mid-tone, pure hue followed by pastel colour:-

  1. blood red, fuzzy wuzzy, red, flat pink.
  2. chocolate, heatland, orange, orangelin.
  3. rusty pelican, tuscany, vitamin c, atomic tangerine.
  4. browser caramel, buddha gold, tangerine, sand.
  5. grass stain, pine glade, yellow, bone.
  6. verdun green, slimer 2, lovely lime, limeade.
  7. pakistan green, weak green, lime, offwhite green.
  8. blue stone, aqua, light teal, baby blue.
  9. navy blue, periwinkle, blue, offwhite blue.
  10. violet, the bands, grape, mauve.
  11. royal purple, calihoe, magenta, magenta shift.
  12. dried blood, forbidden, process pagenta, pink.
  13. white, white wildflower, gray, silver, black

There are 7 flower colours:-
blue, white, yellow, unusual, and red, pink or purple as in the
Bulb gallery.

These are the 12 flower colours for
Flower in Month and Bee-Pollinated Plants:-
red, pink, white, cream, mauve, purple, blue, yellow, brown, green, orange and unusual or multi-coloured.

Foliage Colour:-
I have created a Foliage Colour Wheel -
All Foliage 212 - using 212 web-safe colours. My 212 web-safe colours just do not cut the mustard.
This is instead of using the best Colour Wheel of 2058 colours in the
Pantone Goe System, but this link no longer connects to Pantone. So perhaps the Pantone Goe System is no longer sold or maintained.

So as from 18 January 2021, I have decided to use the 53 colours of All Flowers Colour Wheel and Rock Plant Flowers above for the flowers and the foliage in the future combined with the 14 Flower Colours for the UK Native Wildflowers Wild Flower for the UK Wildflowers. I also intend to put the required plant into the respective pages of the Plant Colour Wheel Uses Gallery.
This makes for a practical number of flower and foliage colours for use in the horticultural environment.

The links in the
PLANT WITH PHOTO INDEX GALLERY PAGES in the previous column link to these pages in this cell

Topic - Camera Photo Galleries showing all 4000 x 3000 pixels of each photo on your screen that you can then click and drag to your desktop:-

RHS Garden at Wisley

Plant Supports -
When supporting plants in a bed, it is found that not only do those plants grow upwards, but also they expand their roots and footpad sideways each year.
Pages
1
, 2, 3, 8, 11,
12, 13,
Plants 4, 7, 10,
Bedding Plants 5,
Plant Supports for Unknown Plants 5
,
Clematis Climbers 6,
the RHS does not appear to either follow it's own pruning advice or advice from The Pruning of Trees, Shrubs and Conifers by George E. Brown.
ISBN 0-571-11084-3 with the plants in Pages 1-7 of this folder. You can see from looking at both these resources as to whether the pruning carried out on the remainder of the plants in Pages 7-15 was correct.

Narcissus (Daffodil) 9,
Phlox Plant Supports 14, 15

Coleus Bedding Foliage Trial -
Pages

1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13, 14, 15,
16, 17, 18, 19, 20,
21, 22, 23, 24, 25,
26, 27, 28, 29, 30,
31, 32, Index

National Trust Garden at Sissinghurst Castle
Plant Supports -
Pages for Gallery 1

with Plant Supports
1, 5, 10
Plants
2
, 3, 4, 6, 7, 8, 9,
11, 12
Recommended Rose Pruning Methods 13
Pages for Gallery 2
with Plant Supports
2
,
Plants 1, 3, 4, 5, 6, 7

Dry Garden of
RHS Garden at
Hyde Hall

Plants - Pages
without Plant Supports
Plants 1
, 2, 3, 4, 5, 6, 7, 8, 9

Nursery of
Peter Beales Roses
Display Garden

Roses Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13

Nursery of
RV Roger

Roses - Pages
A1,A2,A3,A4,A5,
A6,A7,A8,A9,A10,
A11,A12,A13,A14,B15,
B16,B17,B18,B19,B20,
B21,B22,B23,B24,B25,
B26,B27,B28,B29,B30,
C31,C32,C33,C34,C35,
C36,C37,C38,C39,C40,
C41,CD2,D43,D44,D45,
D46,D47,D48,D49,E50,
E51,E52,F53,F54,F55,
F56,F57,G58,G59,H60,
H61,I62,K63,L64,M65,
M66,N67,P68,P69,P70,
R71,R72,S73,S74,T75,
V76,Z77, 78,

Damage by Plants in Chilham Village
- Pages
1, 2, 3, 4

Pavements of Funchal, Madeira
Damage to Trees - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13
for trees 1-54,
14, 15,
16, 17, 18, 19, 20,
21, 22, 23, 24, 25,
for trees 55-95,
26, 27, 28, 29, 30,
31, 32, 33, 34, 35,
36, 37,
for trees 95-133,
38, 39, 40,
41, 42, 43, 44, 45,
for trees 133-166

Chris Garnons-Williams
Work Done - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11, 12, 13

Identity of Plants
Label Problems - Pages
1, 2, 3, 4, 5,
6, 7, 8, 9, 10,
11

Ron and Christine Foord -
1157 photos only inserted so far -

Garden Flowers - Pages
AB1,AC2,AC3,AC4,AC5,
AE6,AG7,AL8,AL9,AL10,
AL11,AM12,AN13,AN14,AN15,
AN16,AN17,AN18,AN19,AQ20,
AR21,AR22,AR23,AR24,AS25,AR26,
for A 279 photos
BA27
,BE28,BE29,BR30,
for B 37 photos

CA31,CA32,CA33,CA34,CA35,
CA36,CA37,CH38,CH39,CH40,
CI41,CL42,CL43,CO44,CO45,
CO46,CO47,CO48,CO49,CR50,
CR51,CR52,CR53,CY54,CY55,
CY56,
for C 285 photos
DA57,DE58,DI59,DI60,
DI61,DO62,DR63,DR64,
for D 84 photos
ED65,
EL66,EP67,ER68,ER69,ER70,
EU71,
for E 86 photos
FO72,FR73,FR74,FR75,
FR76,FU77,FU78,
for F 68 photos
GA79
,GE80,
GE81,GE82,GE83,GE84,GE85,
GL86,GL87,
for G 108 photos

Heather -
Calluna AR88,PE89,
Daboecia BI90,
Erica AR91,CI92,CI93,

HA94,HE95,
HE96,HE97,HE98,HE99,HE100,
HO101,HY102,
for H 164 photos
IB103,IM104,IR105,
IR106,
for I 46 photos
IR107, 108, 109, 110,
111, 112, 113, 114, 115,
116, 117,

When I have completed the conversion of all the slides from Ron and Christine Foord and inserted a relevant selection of the digitised images into the Photo Garden Flowers Galleries in some months time, then I will complete their text field in the thumbnail row starting with the
letter A (11 November 2020).


 

Links to plants in the remainder of this website:-


Flower Colour, Number of Petals, Shape and
Plant Use of:-

Rock Garden
...within linked page


Bedding

...Bedding Out
...Filling In
...Screen-ing
...Pots and Troughs
...Window Boxes
...Hanging Baskets
...Spring Bedding
...Summer Bedding
...Winter Bedding
...Foliage instead of Flower
...
Coleus Bedding Photos for use in Public Domain 1

Bulb
...Other than Only Green Foliage
...Bedding or Mass Planting
...Ground-Cover
...Cut-Flower
...Tolerant of Shade
...In Woodland Areas
...Under-plant
...Tolerant of Poor Soil
...Covering Banks
...In Water
...Beside Stream or Water Garden
...Coastal Conditions
...Edging Borders
...Back of Border or Back-ground Plant
...Fragrant Flowers
...Not Fragrant Flowers
...Indoor
House-plant

...Grow in a Patio Pot
...Grow in an Alpine Trough
...Grow in an Alpine House
...Grow in Rock Garden
...Speciman Plant
...Into Native Plant Garden
...Naturalize in Grass
...Grow in Hanging Basket
...Grow in Window-box
...Grow in Green-house
...Grow in Scree
...Naturalized Plant Area
...Grow in Cottage Garden
...Attracts Butterflies
...Attracts Bees
...Resistant to Wildlife
...Bulb in Soil:-
......Chalk
......Clay
......Sand
......Lime-Free (Acid)
......Peat

Rose
...
Bedding
...
Climber /Pillar
...
Cut-Flower
...
Exhibition, Speciman
...
Ground-Cover

...
Grow In A Container
...
Hedge
...
Climber in Tree
...
Woodland
...Edging Borders
...Tolerant of Poor Soil
...Tolerant of Shade
...Back of Border
...Adjacent to Water
...Page for rose use as ARCH ROSE, PERGOLA ROSE, COASTAL CONDITIONS ROSE, WALL ROSE, STANDARD ROSE, COVERING BANKS or THORNLESS ROSES.
...FRAGRANT ROSES
...NOT FRAGRANT ROSES

and

Colour Wheel Uses
with
1. Why the perfect soil for general use is composed of 8.3% lime, 16.6% humus, 25% clay and 50% sand
within the SOIL TEXTURE, and
2. Why you are continually losing the SOIL STRUCTURE if you leave bare earth between plants so your soil - will revert to clay, chalk, sand or silt - unless you replace that lost humus with an organic mulch.


Uses of Plant and Flower Shape:-
...Foliage Only
...Other than Green Foliage
...Trees in Lawn
...Trees in Small Gardens
...Wildflower Garden
...Attract Bi
rd
...Attract Butterfly
1
, 2
...Climber on House Wall

...
Climber not on House Wall
...Climber in Tree
...Rabbit-Resistant
...Woodland
...Pollution Barrier
...Part Shade
...Full Shade
...Single Flower provides Pollen for Bees
1
, 2, 3
...Ground-Cover
<60
cm
60-180cm
>
180cm
...Hedge
...Wind-swept
...Covering Banks
...Patio Pot
...Edging Borders
...Back of Border
...Poisonous

...Adjacent to Water
...Bog Garden
...Tolerant of Poor Soil
...Winter-Flowering
...Fragrant
...Not Fragrant
...Exhibition

...
Standard Plant
is 'Ball on Stick'
...
Upright Branches or Sword-shaped leaves
...
Plant to Prevent Entry to Human or Animal
...
Coastal Conditions
...
Tolerant on North-facing Wall
...
Cut Flower
...
Potted Veg Outdoors
...
Potted Veg Indoors
...
Thornless
...
Raised Bed Outdoors Veg
...
Grow in Alkaline Soil A-F
, G-L, M-R,
S-Z
...
Grow in Acidic Soil
...
Grow in Any Soil
...
Grow in Rock Garden
...
Grow Bulbs Indoors


Fragrant Plants:-
Sense of Fragrance from Roy Genders

Fragrant Plants:-
Trees and Shrubs with Scented Flowers
1
, 2, 3, 4, 5, 6
Shrubs bearing Scented Flowers for an Acid Soil
1
, 2, 3, 4
Shrubs bearing Scented Flowers for a
Chalky or Limestone Soil
1
, 2, 3, 4
Shrubs bearing Scented leaves for a
Sandy Soil
1
, 2, 3
Herbaceous Plants with Scented Flowers
1
, 2, 3
Annual and Biennial Plants with Scented Flowers or Leaves
1
, 2
Bulbs and Corms with Scented Flowers
1
, 2, 3, 4, 5
Scented Plants of Climbing and Trailing Habit
1
, 2, 3
Winter-flowering Plants with Scented Flowers
1
, 2
Night-scented Flowering Plants
1
, 2
 

 

As photos are added to this index, then if the plant has the relevant photos to be included in the comparison pages in this table, then they shall be included in the relevant Flower Shape and Plant Use gallery below for

  • Bedding
  • Bulb
  • Evergreen Perennial
  • Herbaceous Perennial
  • Rose

Tables of Annuals List in each page of Coleus and Coleus 2 Galleries
Rock Garden
Plants from other Galleries in Colour Wheel Uses Gallery
A complete system for choosing plants for your home, garden and work
Butterflies with their wildflowers
Fragrant Plants
There are other pages on plants that bloom in each month of the year in this website, and
PLANTS Topic has many pages of useful plant lists with another system for choosing plants
 

BEDDING PLANT GALLERY PAGES

Flower Colour

Bicolour

Blue

Green

Orange

Other Colours

Pink

Purple

Red

White

White / Bicolour

Yellow

 

 

 

Flower Simple Shape

3 Petals

4 Petals

5 Petals

6 Petals

Stars

Bowls, Cups and Saucers

Globes, Goblets and Chalices

irisflotpseudacorus1a1a

aethionemacfloarmenumfoord1a1a

anemonecflo1hybridafoord1b1

 

anthericumcfloliliagofoord1a1a

geraniumflocineremuballerina1a1a1a1a1a1

paeoniamlokosewitschiiflot1a1a1

Trumpets and Funnels

Bells, Thimbles and Urns

 

Single Flower provides pollen for bees

 

2 Petals

 

acantholinumcflop99glumaceumfoord3

digitalismertonensiscflorvroger1a1a

 

anagalisflotcskylover1a1a

 

cupheacflollaveakavanagh1a1

 

Flower Elabor-ated Shape

Tubes, Lips and Lobes

Slippers, Spurs and Lockets

Hats, Hoods and Helmets

Standards, Wings and Keels

Discs and Florets

Pin-cushions and Tufts

Rosettes, Buttons and Pompons

prunellaflotgrandiflora1a1a

aquilegiacfloformosafoord1a1a

acanthusspinosuscflocoblands1a1a

lathyrusflotvernus1a1

brachyscomecflorigidulakevock1b1

echinaceacflo1purpurealustrehybridsgarnonswilliams1a1

argyranthemumflotcmadeiracrestedyellow1a1a

Bedding Plant Use

Bedding Out

Filling In

Screen-ing

Pots and Troughs

Window Boxes

Hanging Baskets

Spring Bedding

Summer Bedding

Winter Bedding

Foliage instead of Flower


Bedding Photos
for use in Public Domain 1

 

Bedding Plant Height from Text Border Gallery

Blue =
0-24 inches
(0-60 cms)

Green =
24-72 inches
(60-180 cms) or
Green =
24-72 inches
(60-180 cms)

Red =
72+ inches
(180+ cms)
 

Bedding Plant Soil Moisture from Text Background

 

Wet Soil

Moist Soil

Dry Soil

Click on thumbnail to change this Comparison Page to the Plant Description Page of the Bedding Plant named in the Text box below that photo.


The Comments Row of that Bedding Plant Description Page details where that Bedding Plant is available from.

From

Ivydene Gardens Bulb Flower Shape, Bulb Form, Bulb Use and Bulb in Soil Gallery:

BULB FLOWER SHAPE GALLERY PAGES

lessershapemeadowrue2a1a1a1

alliumcflohaireasytogrowbulbs1a

berberisdarwiniiflower10h3a14c2b1

irisflotpseudacorus2a

aethionemacfloarmenumfoord3a

anemonecflo1hybridafoord2a

anemonecflo1blandafoord2a

Number of Flower Petals

Petal-less

1

2

3

4

5

Above 5

 

anthericumcfloliliagofoord1c1

alliumcflo1roseumrvroger1a

geraniumflocineremuballerina1a1a1a1b1

paeoniamlokosewitschiiflot1b1

paeoniaveitchiiwoodwardiiflot1a

acantholinumcflop99glumaceumfoord2

stachysflotmacrantha1a1

Flower Shape - Simple

Stars with Single Flowers

Bowls

Cups and Saucers

Globes

Goblets and Chalices

Trumpets

Funnels

 

digitalismertonensiscflorvroger2a

fuchsiaflotcalicehoffman1a1

ericacarneacflosspringwoodwhitedeeproot1a2a

phloxflotsubulatatemiskaming1a1

 

 

 

Flower Shape - Simple

Bells

Thimbles

Urns

Salver form

 

 

 

 

prunellaflotgrandiflora3a

aquilegiacfloformosafoord3a

acanthusspinosuscflocoblands2a

lathyrusflotvernus2a

anemonecflo1coronariastbrigidgeetee1a

echinaceacflo1purpurealustrehybridsgarnonswilliams2a

centaureacfloatropurpureakavanagh1a

Flower Shape - Elabor-ated

Tubes, Lips and Straps

Slippers, Spurs and Lockets

Hats, Hoods and Helmets

Stan-dards, Wings and Keels

Discs and Florets

Pin-Cushions

Tufts and Petal-less Cluster

 

androsacecforyargongensiskevock2a

androsacecflorigidakevock1a

argyranthemumflotcmadeiracrestedyellow2a

armeriacflomaritimakevock1a

anemonecflonemerosaalbaplenarvroger1a

 

 

Flower Shape - Elabor-ated

Cushion

Umbel

Buttons with Double Flowers

Pompoms

Stars with Semi-Double Flowers

 

 

 

bergeniamorningredcforcoblands1a1

ajugacfloreptansatropurpurea1a2

lamiumflotorvala2a1

astilbepurplelancecflokevock1a1

berberisdarwiniiflower10h3a1433a1a1a1

berberisdarwiniiflower10h3a1434a1a1a1

androsacecfor1albanakevock2a

Natural Arrange-ments

Bunches, Posies and Sprays (Group)

Columns, Spikes and Spires

Whorls, Tiers and Cande-labra

Plumes and Tails

Chains and Tassels

Clouds, Garlands and Cascades

Sphere, Dome (Clusters), Drumstick and Plate

 

 

 

 

 

 

 

 

BULB
FORM, BULB USE AND BULB IN SOIL GALLERY PAGES

 

 

 

 

 

 

 

Bulb Form

Mat-Forming

Prostrate or Trailing

Cushion or Mound-forming

Spreading or Creeping

Clump-forming

Stemless. Sword-shaped Leaves

Erect or Upright

Bulb Use

Other than Only Green Foliage

Bedding or Mass Planting

Ground-Cover

Cut-Flower

Tolerant of Shade

In Woodland Areas

Under-plant

Tolerant of Poor Soil

Covering Banks

In Water

Beside Stream or Water Garden

Coastal Conditions

Edging Borders

Back of Border or Back-ground Plant

Fragrant Flowers

Not Fragrant Flowers

Indoor House-plant

Grow in a Patio Pot

Grow in an Alpine Trough

Grow in an Alpine House

Grow in Rock Garden

Speciman Plant

Into Native Plant Garden

Naturalize in Grass

Grow in Hanging Basket

Grow in Window-box

Grow in Green-house

Grow in Scree

 

 

Natural-ized Plant Area

Grow in Cottage Garden

Attracts Butter-flies

Attracts Bees

Resistant to Wildlife

Bulb in Soil

Chalk

Clay

Sand

Lime-Free (Acid)

Peat

 

 

 

 

 

 

 

 

 

 

Bulb Height from Text Border

Brown= 0-12 inches (0-30 cms)

Blue = 12-24 inches (30-60 cms)

Green= 24-36 inches (60-90 cms)

Red = 36+ inches (90+ cms)

Bulb Soil Moisture from Text Background

Wet Soil

Moist Soil

Dry Soil

Flowering months range abreviates month to its first 3 letters (Apr-Jun is April, May and June).

Click on thumbnail to change this comparison page to the Plant Description Page of the Bulb named in the Text box below that photo.
The Comments Row of that Plant Description Page links to where you personally can purchase that bulb via mail-order.

 

Ivydene Gardens Evergreen Perennials and Alpine Evergreen Perennials Flower Shape Gallery:
Site Map

EVERGREEN PERENNIAL FLOWER SHAPE - Click on Text link in row below thumbnail

 

 

 

 

 

 

 

 

 

lessershapemeadowrue1a1

berberisdarwiniiflower10h3a14c1a1a

berberisdarwiniiflower10h3a14c2a1a

berberisdarwiniiflower10h3a14d1a1a

aethionemacfloarmenumfoord2a1

anemonecflo1hybridafoord1a2a

anemonecflo1blandafoord1a1a

Number of Flower Petals

Petal-less

1

2

3

4

5

Above 5

 

 

 

 

 

 

 

 

 

anthericumcfloliliagofoord1b1a

berberisdarwiniiflower10h3a14k1c1a

geraniumflocineremuballerina1a1a

berberisdarwiniiflower10h3a14k1a1a1a

berberisdarwiniiflower10h3a14k1b1a1

acantholinumcflop99glumaceumfoord1

stachysflotmacrantha2a

Flower Shape - Simple

Stars

Bowls

Cups and Saucers

Globes

Goblets and Chalices

Trumpets

Funnels

 

berberisdarwiniiflower10h3a14q1a1a

berberisdarwiniiflower10h3a14r1a1a

berberisdarwiniiflower10h3a14s1a1a

phloxflotsubulatatemiskaming2a

 

 

 

Flower Shape - Simple

Bells

Thimbles

Urns

Salverform

 

 

 

 

 

 

 

 

 

 

 

 

prunellaflotgrandiflora2a1

aquilegiacfloformosafoord2a1

berberisdarwiniiflower10h3a14u1a1a

berberisdarwiniiflower10h3a14v1a1a

brachyscomecflorigidulakevock1a2a

berberisdarwiniiflower10h3a14x1a1a

berberisdarwiniiflower10h3a14y1a1a

Flower Shape - Elabor-ated

Tubes, Lips and Straps

Slippers, Spurs and Lockets

Hats, Hoods and Helmets

Stan-dards, Wings and Keels

Discs and Florets

Pin-Cushions

Tufts

 

androsacecforyargongensiskevock1a1a

androsaceflorigidakevock1a

berberisdarwiniiflower10h3a1428a1a1

armeriaflomaritimakevock1a

 

 

 

Flower Shape - Elabor-ated

Cushion

Umbel

Buttons

Pompoms

 

 

 

 

 

 

 

 

 

 

 

 

bergeniamorningredcforcoblands2a

ajugacfloreptansatropurpurea1a2a

berberisdarwiniiflower10h3a1431a1a1

berberisdarwiniiflower10h3a1432a1a1

berberisdarwiniiflower10h3a1433a1a1a

berberisdarwiniiflower10h3a1434a1a1a

androsacecfor1albanakevock1a1a

Natural Arrange-ments

Bunches, Posies and Sprays

Columns, Spikes and Spires

Whorls, Tiers and Candle-labra

Plumes and Tails

Chains and Tassels

Clouds, Garlands and Cascades

Spheres, Domes and Plates

 


HERBACEOUS FLOWER SHAPE Gallery Comparison Pages
 

 

lessershapemeadowrue2a1a1a1a1a

berberisdarwiniiflower10h3a14c1a1a1a1a

berberisdarwiniiflower10h3a14c2a1a1a1

irisflotpseudacorus1a1a1

aethionemacfloarmenumfoord1a1a1

anemonecflo1hybridafoord1a1a1

anemonecflo1blandafoord1a1a1

Number of Flower Petals

Petal-less

1

2

3

4

5

Above 5

 

anthericumcfloliliagofoord1a1a1a

berberisdarwiniiflower10h3a14k1a1a1a1

geraniumflocineremuballerina1a1a1a1a1a1a

paeoniamlokosewitschiiflot1a1a1a

paeoniaveitchiiwoodwardiiflot1a1a

acantholinumcflop99glumaceumfoord

stachysflotmacrantha1a1a1

Flower Shape - Simple

Stars

Bowls

Cups and Saucers

Globes

Goblets and Chalices

Trumpets

Funnels

 

digitalismertonensiscflorvroger1a1a1

fuchsiaflotcalicehoffman1a1a1a

ericacarneacflosspringwoodwhitedeeproot1a1a1

phloxflotsubulatatemiskaming1a1a1a

 

 

 

Flower Shape - Simple

Bells

Thimbles

Urns

Salverform

 

 

 

 

prunellaflotgrandiflora1a1a1

aquilegiacfloformosafoord1a1a1

acanthusspinosuscflocoblands1a1a1

lathyrusflotvernus1b1a1

brachyscomecflorigidulakevock1a1a1

echinaceacflo1purpurealustrehybridsgarnonswilliams1a1a1a

centaureacfloatropurpureakavanagh1a1a1

Flower Shape - Elabor-ated

Tubes, Lips and Straps

Slippers, Spurs and Lockets

Hats, Hoods and Helmets

Stan-dards, Wings and Keels

Discs and Florets

Pin-Cushions

Tufts

 

androsacecforyargongensiskevock1a1a1

androsacecflorigidakevock1a1a1

argyranthemumflotcmadeiracrestedyellow1a1a1

armeriacflomaritimakevock1a1a1

 

 

 

Flower Shape - Elabor-ated

Cushion

Umbel

Buttons

Pompoms

 

 

 

 

bergeniamorningredcforcoblands1a1a1a

ajugacfloreptansatropurpurea1a1a1

lamiumflotorvala2a1a1a

astilbepurplelancecflokevock1a1a1a

berberisdarwiniiflower10h3a1433a1a1a1a1a

berberisdarwiniiflower10h3a1434a1a1a1a1a

androsacecfor1albanakevock1a1a1

Natural Arrange-ments

Bunches, Posies and Sprays

Columns, Spikes and Spires

Whorls, Tiers and Cande-labra

Plumes and Tails

Chains and Tassels

Clouds, Garlands and Cascades

Spheres, Domes and Plates

Ivydene Gardens Rose Use Gallery: Site Map

Flower Colour

Other Colours

Orange

Pink

Red

White

Yellow

2 or More Colours Page 1

2 or More Colours Page 2

Produces Hips

Rose Use

Bedding

Climber /Pillar

Cut-Flower

Exhibition, Speciman

Ground-Cover

Grow In A Container

Hedge

Climber in Tree

Woodland

Edging Borders

Tolerant of Poor Soil

Tolerant of Shade

Back of Border

Adjacent to Water

On North-Facing Wall

Page for rose use as ARCH ROSE, PERGOLA ROSE, COASTAL CONDITIONS ROSE, WALL ROSE, STANDARD ROSE, COVERING BANKS or THORNLESS ROSES.

FRAGRANT ROSES - The roses inserted into this page are described as Moderately Fragrant or Very Fragrant in the relevant Rose Plant Description Page.

NOT FRAGRANT ROSES - The roses inserted into this page are described as Slightly Fragrant or nothing mentioned about fragrance in the relevant Rose Plant Description Page.
 

Rose Bloom Shape

rosaacapulcocflo1a1a1
High Centred

rosaamberqueenflomidcgarnonswilliams1a1a1a
Cupped

rosaballerinacflorogerltd1a1a
Flat

rosahenrimartincflorogerltd1a1a
Globular

rosabuffbeautyCflorogerltd1a1a
Pompon

rosaprosperitycflorogerltd1a1a
Rosette

 

Click on thumbnail to change to Plant Description Page of the Rose Plant named in the text below that photo where its text border is Cyan, Green or Pink.
The Comments Row of that Rose Plant Description Page details where that Rose Plant is available from.

Rose Petal Count

rosacantabrigiensiscflorogerltd1a1a
Single:

1-7
Petals

rosafragrantdelightcflo1a1a1
Semi-double: 8-15 Petals

rosaarthurbellcflomid2garnonswilliams1a1a1
Double:

16-25 Petals

rosagoldenramblercflorogerltd1a1
Full:

26-40 Petals

rosabobwoolleycflorogerltd1a1
Very Full:

40+ Petals

 

Rose Plant Height from Text Border
(1 inch = 2.5 cms,
12 inches = 1 foot = 30 cms,
24 inches = 2 feet)

Blue = 0-24 inches (0-60 cms)
Cyan = 0-24 inches (0-60 cms)

Green=24-72 inches (60-180 cms)
Green=24-72 inches (60-180 cms)

Red = 72+ inches (180+ cms)
Pink = 72+ inches (180+ cms)

Rose Plant Soil Moisture from Text Background

Wet Soil

Moist Soil

Dry Soil

Click on thumbnail to add the Rose Plant Description Page of the Rose Plant named in the Text box below that photo - or - click that Rose Plant name in the relevant "Roses in this Gallery Link Index" menu for non-users of pop-up windows such as for IPHONE users, where the text border is Blue, Green or Red.

 

What are garden 'thug' plants?

 

Invasive plants are those that can quickly get out of hand in the garden, even though they are not regarded as weeds and are commonly sold in garden centres.

Think carefully about introducing these plants to your garden, and be prepared to carry out judicious pruning and digging or thinning out as required.

Examples of such plants include:

Trees and shrubs

  • Cherry laurel (Prunus laurocerasus)
  • False acacia (Robinia pseudoacacia)
  • Kerria japonica
  • Leyland cypress (× Cuprocyparis leylandii)
  • Poplars (Populus spp.)
  • Sumach (Rhus typhina)

Climbers

  • Passion flower (Passiflora caerulea)
  • Russian vine (Fallopia baldschuanica)

Bamboos, sedges, reeds and grasses

  • Sasa palmata (see our bamboo profile for a fuller list of invasive bamboos)
  • Phalaris arundinacea
  • Phragmites australis
  • Weeping sedge (Carex pendula)

Herbaceous perennials

  • Japanese anemone (Anemone × hybrida cultivars)
  • Golden rod (Solidago canadensis)
  • Houttuynia cordata ‘Chameleon’
  • Macleaya spp.
  • Yellow loosestrife (Lysimachia punctata)

Crevice plants

  • Mind-your-own-business (Soleirolia soleirolii)

Edible crops

  • Blackberries
  • Raspberries
  • Horseradish
  • Mint

Ground cover plants

  • Euphorbia cyparissias
  • Hypericum calycinum
  • Leptinella squalida
  • Periwinkle (Vinca major and V. minor)
  • Pratia pedunculata
  • Rubus biflorus
  • Snowberry (Symphoricarpos albus)
  • Yellow archangel (Lamium galeobdolon) 

Bulbous plants

  • Lesser celandine (Ranunculus ficaria) cultivars
  • Oxalis culitvars
  • Allium paradoxum and A. triquetrum

Pond plants

There are a number of aquatic plants that can easily get out of hand in a garden pond and are considered true weeds. Ideally these should never be introduced to the pond, though they sometimes come unwittingly with other pond plants.

Continued in next column.

Uses of Rock Garden Plants with
Links from Colour Wheel Rock Gallery:-

ROCK GARDEN PLANTS IN COLOUR WHEEL GALLERY PAGES

Small size plant in Flower Colours

Miniature size plant in Flower Colours

Small Size plant flower in Month

Miniature Size plant flower in Month

FLOWERING IN MONTH
including those from the Camera Photo Galleries as detailed in row 3 of the Topic Table on the left.
Click on the centre of each thumbnail in the following flower colour month pages to transfer to the description of that plant in a Camera Photo Gallery Page:-
January
February
March
April
May
June
July
August
September
October
November
December

Dark Tone or Shades
(Colours mixed with Black)
Mid-Tone
(Colours mixed with Grey)
Pure Hue
(the Primary, Secondary or Tertiary Colour named)
Pastel
(Colours mixed with White)

Garden Thug Plants continued:-
The problems

Trees like the Leyland cypress and climbers such as Russian vine can grow so quickly that they are soon much too big for the garden.

Trees such as poplar and sumach have a tendency to sucker, sending up shoots all over the garden and even in neighbours’ properties.

Many ground cover shrubs like the snowberry or Hypericum calycinum spread via underground stems (rhizomes), sending up new plants and gradually taking over the border. Some bamboos also behave in this way, becoming a constant source of regret for the gardener.

Potentially invasive herbaceous plants and grasses, such as Japanese anemones and Phalaris arundinacea, form ever-enlarging clumps that require frequent division. Others, such as golden rod or weeping sedge also spread by seed, with seedlings popping-up in unexpected places where they are not wanted.

Bulbous plants such as Oxalis can produce tiny new bulbs, or offsets, which are scattered every time a clump is dug up, spreading the problem rather than controlling it.

 

Control

Digging out unwanted plants may work for a while, but is only likely to be a temporary solution. Judicious use of weedkillers may be necessary.

For herbaceous weeds, try a programme of spraying using a systemic herbicide containing glyphosate – Roundup and Tumbleweed are common brand names of such products. For woodier plants, choose a stump or brushwood killer such as ‘Bramble Killer Ultra’ or ‘Deep Root Ultra Tree Stump & Weedkiller’.

Beware putting invasive plants on the domestic compost heap, as this is unlikely to reach a high enough temperature to kill off tough roots or underground stems (it is all right if they have already been killed off with weedkiller). Instead, place them in the municipal green waste, as this is composted on an industrial scale, where tough weeds should be killed off. Burning may also be appropriate, but check your local Council guidelines.

Uses of Rock Garden Plants with
Links from Colour Rock Photos
 

PAGES FOR PHOTOS OF ROCK GARDEN PLANTS WHO DO NOT HAVE THEIR OWN PLANT DESCRIPTION PAGE

ROCK GARDEN PLANT INDEX
(o)Rock Plant: A
(o)Rock Plant: B
(o)Rock Plant: C
(o)Rock Plant: D
(o)Rock Plant: E
(o)Rock Plant: F
(o)Rock Plant: G
(o)Rock Plant: H
(o)Rock Plant: I
(o)Rock Plant: J
(o)Rock Plant: K
(o)Rock Plant: L
(o)Rock Plant: M
(o)Rock Plant: NO
(o)Rock Plant: PQ
(o)Rock Plant: R
(o)Rock Plant: S
(o)Rock Plant: T
(o)Rock Plant: UVWXYZ

 

LISTS OF PLANTS SUITABLE FOR VARIOUS SITUATIONS AND PURPOSES:-

THE ROCK GARDEN -

Rock plants for Sunny Sites.

Rock plants for Shady Sites.

Early Bloom in the Rock Garden.

Summer Bloom in the Rock Garden.

Late Bloom in the Rock Garden.

Rock plants of Creeping and Trailing Habit.

Rock plants with Evergreen Foliage.

Rock Plants with Silvery or Variegated Foliage.

Rock plants needing the protection of Sheet of Glass in Winter.

Rock plants which hate Lime.

Lime Lovers.

Peat Lovers.

THE WALL GARDEN -

Plants for sunny sites in the Wall Garden.

Plants for Shady Sites in the Wall Garden.

Plants for a Dry Site on a Wall.

Plants for a Moderately Dry Site on a Wall.

Plants for a Moist Site on a Wall.

Plants for Positions on Top of Walls.

Plants to Hang Down from the Upper Parts of a Wall.
 

 

DETAILS OF PLANTS IN LISTS FOR THE ROCK, WALL, PAVED, WATER AND BOG GARDENS

Some Good Rock Plants with Some on Moraine

Plants for the Alpine House

Plants for the Miniature Rock Garden with some Bulbs

Shrubs for the Rock Garden

Moisture-loving Trees and Shrubs for Bog or Water Garden

Ferns

Plants for Wall Garden and Paved Garden

Plants for the Water Garden

Plants for the Bog Garden

Plants from other Galleries except the ones in the next row

 

IVYDENE GARDENS COLOUR WHEEL PLANT USE AND FLOWER SHAPE GALLERY PAGES

 

Additions to Ivydene Gardens Colour Wheel Uses Gallery from this Index

  • will compare the use and flower shape of the to be added shrubs and trees, since currently until August 2019 there is no comparison pages for uses of shrubs and trees,
  • will compare the uses of the to be added evergreen and herbaceous perennials, since currently until August 2019 there is no comparison pages for uses of perennials.
  • The above additions will be combined with those already compared from Bedding, Bulb, Evergreen Perennial, Herbaceous Perennial and Roses pages.
    Bedding, Bulb, and Roses currently in August 2019 have comparison pages for both use and flower shape.
     

PLANTS FLOWER SHAPE GALLERY PAGES

lessershapemeadowrue2a1a1a1a1a1a1a1a

alliumcflohaireasytogrowbulbs1a1a1a1a1

berberisdarwiniiflower10h3a14c2a1a1a1a1a1a

irisflotpseudacorus1a1a1a1a1a1a

aethionemacfloarmenumfoord1a2a1a1a1a1

anemonecflo1hybridafoord1a2a1a1a1a1

anemonecflo1blandafoord1a1a1a1a1a1

Number of Flower Petals

Petal-less

1

2

3

4

5

Above 5

 

anthericumcfloliliagofoord1a1a1a1a1a1a1

alliumcflo1roseumrvroger1a1a1a1a

geraniumflocineremuballerina1a1a1a1a1a1a1a1a1a1

paeoniamlokosewitschiiflot1a1a1a1a1a1a1

paeoniaveitchiiwoodwardiiflot1a1a1a1a1a1

acantholinumcflop99glumaceumfoord2d1

stachysflotmacrantha1a1a1a1a1a1a

Flower Shape - Simple

Stars with Single Flowers

Bowls

Cups and Saucers

Globes

Goblets and Chalices

Trumpets

Funnels

 

digitalismertonensiscflorvroger1a2a1a1a1a1

fuchsiaflotcalicehoffman1a1a1a1a1a1a

ericacarneacflosspringwoodwhitedeeproot1a1a1a1a1a1a1

phloxflotsubulatatemiskaming1a1a1a1a1a1a

 

 

 

Flower Shape - Simple

Bells

Thimbles

Urns

Salver-form

 

 

 

 

prunellaflotgrandiflora1a1a1a1a1a1

aquilegiacfloformosafoord1a2a1a1a1a

acanthusspinosuscflocoblands1a2a1a1a1a

lathyrusflotvernus1a2a1a1a1a

anemonecflo1coronariastbrigidgeetee1a1a1a1a

echinaceacflo1purpurealustrehybridsgarnonswilliams1a2a1a1a1a

centaureacfloatropurpureakavanagh1a1a1a1a1a

Flower Shape - Elabor-ated

Tubes, Lips and Straps

Slippers, Spurs and Lockets

Hats, Hoods and Helmets

Stan-dards, Wings and Keels

Discs and Florets

Pin-Cushions

Tufts and Petal-less Cluster

 

androsacecforyargongensiskevock1a1a1a1a1

androsacecflorigidakevock1a1a1a1a1

argyranthemumflotcmadeiracrestedyellow1a1b1a1a1

armeriacflomaritimakevock1a1a1a1a1

anemonecflonemerosaalbaplenarvroger1a1a1a1a1

 

 

Flower Shape - Elabor-ated

Cushion

Umbel

Buttons with Double Flowers

Pompoms

Stars with Semi-Double Flowers

 

 

 

bergeniamorningredcforcoblands1a1a1a1a1a1

ajugacfloreptansatropurpurea1a1a1a1a1a

lamiumflotorvala2a1a1a1a1a1

astilbepurplelancecflokevock1a1a1a1a1a1

berberisdarwiniiflower10h3a1433a1a1a1a1a1a1a1

berberisdarwiniiflower10h3a1434a1a1a1a1a1a1a1

androsacecfor1albanakevock1a1a1a1a1a

Natural Arrange-ments

Bunches, Posies and Sprays (Group)

Columns, Spikes and Spires

Whorls, Tiers and Cande-labra

Plumes and Tails

Chains and Tassels

Clouds, Garlands and Cascades

Sphere, Dome (Clusters), Drumstick and Plate

Plant Use

Foliage Only

Other than Green Foliage

Trees in Lawn

Trees in Small Gardens
 

Wildflower Garden

Attract Bird
Attract Butterfly
1
, 2

Climber on House Wall

Climber not on House Wall

Climber in Tree

Rabbit-Resistant
 

Woodland

Pollution Barrier

Part Shade

Full Shade

Single Flower provides Pollen for Bees
1
, 2, 3

Ground-Cover
<60
cm
60-180cm
>180cm

Hedge

Wind-swept

Covering Banks

Patio Pot

Edging Borders

Back of Border

Poisonous

Adjacent to Water

Bog Garden
 

Tolerant of Poor Soil

Winter-Flowering
 

Fragrant

Not Fragrant

Exhibition

Standard Plant is 'Ball on Stick'

Upright Branches or Sword-shaped leaves

Plant to Prevent Entry to Human or Animal

Coastal Con-ditions

Tolerant on North-facing Wall

Cut Flower

Potted Veg Outdoors

Potted Veg Indoors
 

Thornless

Raised Bed Outdoors Veg
 

Grow in Alkaline Soil A-F, G-L, M-R, S-Z

Grow in Acidic Soil

Grow in Any Soil

Grow in Rock Garden

Grow Bulbs Indoors

A complete system for choosing plants for your home, garden and at work.

The following table shows the linkages for the information about the plants
described in Sanders' Encyclopedia of Gardening in The Gardeners' Golden Treasury, revised by A. G. L Hellyer F.L.S, Editor of 'Amateur Gardening', (thirty-first impression of original published in 1895) was published in 1960 by W. H. & L. Collingridge Limited,
between:-

STAGE 4D
SHAPE, FORM INDEX GALLERY

Plant Foliage

Aromatic Foliage

1

Autumn Foliage

1

Finely Cut Leaves

1

Large Leaves

1

Yellow Variegated Foliage

1

White Variegated Foliage

1

Red / Purple Variegated Foliage

1

Silver, Grey and Glaucous Foliage

1

Sword-shaped Leaves

1

 

 

 

STAGE 4D
SHAPE, FORM INDEX GALLERY

Shrub, Tree Shape

Columnar
ccolumnarshape1a1a1a1a1a1a

1

Oval
covalshape1a1a1a1a1a1a

1

Rounded or Spherical
croundedshape1a1a1a1a1a1a

1

Flattened Spherical
cflattenedsphericalshape1a1a1a1a1a1a

1

Narrow Conical / Narrow Pyramidal
cnarrowconicalshape1a1a1a1a1a1a

1

Broad Conical / Broad Pyramidal
cbroadpyramidalshape1a1a1a1a1a1a

1

Ovoid /
Egg-Shaped

ceggshapedshape1a1a1a1a1a1a

1

Broad Ovoid
cbroadovoidshape1a1a1a1a1a1a

1

Narrow Vase-shaped / Inverted Ovoid
cnarrowvaseshapedshape1a1a1a1a1a1a

1

Fan-Shaped /Vase-Shaped
cfanshapedshape1a1a1a1a1a1a

1

Broad Fan-Shaped / Broad Vase-Shaped
cbroadfanshapedshape1a1a1a1a1a1a

1

Narrow Weeping
cnarrowweepingshape1a1a1a1a1a1a

1

Broad Weeping
cbroadweepingshape1a1a1a1a1a1a

1

Palm

1

 

Conifer Cone

1

 

Form

Arching

1

Climbing

1

Clump-Forming

1

Mat-Forming

1

Mound-Forming

1

Prostrate

1

Spreading

1

Stemless

1

Upright

1

 

Poisonous Plant

1

 

STAGE 4D
SHAPE, FORM INDEX GALLERY

Plant Foliage

STAGE 4D
SHAPE, FORM INDEX GALLERY

Tree and Shrubs in Garden Design -

Trees and Shrubs suitable for Clay Soils (neutral to slightly acid)

Trees and Shrubs suitable for Dry Acid Soils

Trees and Shrubs suitable for Shallow Soil over Chalk

Trees and Shrubs tolerant of both extreme Acidity and Alkalinity

Trees and Shrubs suitable for Damp Sites

Trees and Shrubs suitable for Industrial Areas

Trees and Shrubs suitable for Cold Exposed Areas

Trees and Shrubs suitable for Seaside Areas

Shrubs suitable for Heavy Shade

Shrubs and Climbers suitable for NORTH- and EAST-facing Walls

Shrubs suitable for Ground Cover

Trees of Pendulous Habit

Trees and Shrubs of Upright or Fastigiate Habit

Trees and Shrubs with Ornamental Bark or Twigs

Trees and Shrubs with Bold Foliage

Trees and Shrubs for Autumn Colour

Trees and Shrubs with Red or Purple Foliage

Trees and Shrubs with Golden or Yellow Foliage

Trees and Shrubs with Grey or Silver Foliage

Trees and Shrubs with Variegated Foliage

Trees and Shrubs bearing Ornamental Fruit

Trees and Shrubs with Fragrant or Scented Flowers

Trees and Shrubs with Aromatic Foliage

Flowering Trees and Shrubs for Every Month:-
Jan
, Feb, Mar, Apr, May, Jun, Jul, Aug, Sep, Oct, Nov, Dec

 

STAGE 1
GARDEN STYLE INDEX GALLERY

 

Fragrant Plants adds the use of another of your 5 senses in your garden:-
Sense of Fragrance from Roy Genders

Fragrant Plants:-
Trees and Shrubs with Scented Flowers
1
, 2, 3, 4, 5, 6

Trees and Shrubs with Scented Leaves
1
, 2, 3, 4, 5

Trees and Shrubs with Aromatic Bark
1
, 2, 3

Shrubs bearing Scented Flowers for an
Acid Soil
1
, 2, 3, 4

Shrubs bearing Scented Flowers for a
Chalky or Limestone Soil
1
, 2, 3, 4

Shrubs bearing Scented leaves for a
Sandy Soil
1
, 2, 3

Herbaceous Plants with Scented Flowers
1
, 2, 3

Herbaceous Plants with Scented Leaves
1
, 2, 3

Annual and Biennial Plants with Scented Flowers or Leaves
1
, 2

Bulbs and Corms with Scented Flowers
1
, 2, 3, 4, 5

Scented Plants of Climbing and Trailing Habit
1
, 2, 3

Winter-flowering Plants with Scented Flowers
1
, 2

Night-scented Flowering Plants
1
, 2

Scented Aquatic Plants
1


Plants with Scented Fruits
1


Plants with Scented Roots
1
, 2

Trees and Shrubs with Scented Wood
1


Trees and Shrubs with Scented Gums
1


Scented Cacti and Succulents
1


Plants bearing Flowers or Leaves of Unpleasant Smell
1
, 2
 

 

with more details below on the Perfume Groups

Butterflies

 

Now we do of course have WILDFLOWERS and these can be very useful to
BUTTERFLIES and their young

 

Butterfly
Usage of Plants
by Egg, Caterpillar, Chrysalis and Butterfly

Egg, Caterpillar, Chrysalis and Butterfly usage of
Plant A-C
Plant C-M
Plant N-W
Butterfly usage of Plant

 

 

and these wildflowers come from these
WILDFLOWER FAMILIES:-

WILD FLOWER FAMILY
PAGE MENU 1


(o)Adder's Tongue
Amaranth
(o)Arrow-Grass
(o)Arum
(o)Balsam
Bamboo
(o)Barberry
(o)Bedstraw
(o)Beech
(o)Bellflower
(o)Bindweed
(o)Birch
(o)Birds-Nest
(o)Birthwort
(o)Bogbean
(o)Bog Myrtle
(o)Borage
(o)Box
(o)Broomrape
(o)Buckthorn
(o)Buddleia
(o)Bur-reed
(o)Buttercup
(o)Butterwort
(o)Cornel (Dogwood)
(o)Crowberry
(o)Crucifer (Cabbage/Mustard) 1
(o)Crucifer (Cabbage/Mustard) 2
Cypress
(o)Daffodil
(o)Daisy
(o)Daisy Cudweeds
(o)Daisy Chamomiles
(o)Daisy Thistle
(o)Daisy Catsears
(o)Daisy Hawkweeds
(o)Daisy Hawksbeards
(o)Daphne
(o)Diapensia
(o)Dock Bistorts
(o)Dock Sorrels

WILD FLOWER FAMILY
PAGE MENU 2


(o)Clubmoss
(o)Duckweed
(o)Eel-Grass
(o)Elm
(o)Filmy Fern
(o)Horsetail
(o)Polypody
Quillwort
(o)Royal Fern
(o)Figwort - Mulleins
(o)Figwort - Speedwells
(o)Flax
(o)Flowering-Rush
(o)Frog-bit
(o)Fumitory
(o)Gentian
(o)Geranium
(o)Glassworts
(o)Gooseberry
(o)Goosefoot
(o)Grass 1
(o)Grass 2
(o)Grass 3
(o)Grass Soft Bromes 1
(o)Grass Soft Bromes 2
(o)Grass Soft Bromes 3 (o)Hazel
(o)Heath
(o)Hemp
(o)Herb-Paris
(o)Holly
(o)Honeysuckle
(o)Horned-Pondweed
(o)Hornwort
(o)Iris
(o)Ivy
(o)Jacobs Ladder
(o)Lily
(o)Lily Garlic
(o)Lime
(o)Lobelia
(o)Loosestrife
(o)Mallow
(o)Maple
(o)Mares-tail
(o)Marsh Pennywort
(o)Melon (Gourd/Cucumber)
 

WILD FLOWER FAMILY
PAGE MENU 3


(o)Mesem-bryanthemum
(o)Mignonette
(o)Milkwort
(o)Mistletoe
(o)Moschatel
Naiad
(o)Nettle
(o)Nightshade
(o)Oleaster
(o)Olive
(o)Orchid 1
(o)Orchid 2
(o)Orchid 3
(o)Orchid 4
(o)Parnassus-Grass
(o)Peaflower
(o)Peaflower Clover 1
(o)Peaflower Clover 2
(o)Peaflower Clover 3
(o)Peaflower Vetches/Peas
Peony
(o)Periwinkle
Pillwort
Pine
(o)Pink 1
(o)Pink 2
Pipewort
(o)Pitcher-Plant
(o)Plantain
(o)Pondweed
(o)Poppy
(o)Primrose
(o)Purslane
Rannock Rush
(o)Reedmace
(o)Rockrose
(o)Rose 1
(o)Rose 2
(o)Rose 3
(o)Rose 4
(o)Rush
(o)Rush Woodrushes
(o)Saint Johns Wort
Saltmarsh Grasses
(o)Sandalwood
(o)Saxifrage
 

WILD FLOWER FAMILY
PAGE MENU 4


Seaheath
(o)Sea Lavender
(o)Sedge Rush-like
(o)Sedges Carex 1
(o)Sedges Carex 2
(o)Sedges Carex 3
(o)Sedges Carex 4
(o)Spindle-Tree
(o)Spurge
(o)Stonecrop
(o)Sundew
(o)Tamarisk
Tassel Pondweed
(o)Teasel
(o)Thyme 1
(o)Thyme 2
(o)Umbellifer 1
(o)Umbellifer 2
(o)Valerian
(o)Verbena
(o)Violet
(o)Water Fern
(o)Waterlily
(o)Water Milfoil
(o)Water Plantain
(o)Water Starwort
Waterwort
(o)Willow
(o)Willow-Herb
(o)Wintergreen
(o)Wood-Sorrel
(o)Yam
(o)Yew

Fragrant Plants

 

 

Perhaps FRAGRANT PLANTS might be useful to you:-

 

 

Sense of Fragrance from Roy Genders

Fragrant Plants:-
Trees and Shrubs with Scented Flowers 1, 2, 3, 4, 5, 6
Trees and Shrubs with Scented Leaves 1, 2, 3, 4, 5
Trees and Shrubs with Aromatic Bark 1, 2, 3
Shrubs bearing Scented Flowers for an
Acid Soil 1
, 2, 3, 4
Shrubs bearing Scented Flowers for a
Chalky or Limestone Soil 1
, 2, 3, 4
Shrubs bearing Scented Flowers for a
Sandy Soil 1
, 2, 3
Herbaceous Plants with Scented Flowers 1, 2, 3
Herbaceous Plants with Scented Leaves 1, 2, 3
Annual and Biennial Plants with Scented Flowers or Leaves 1, 2
Bulbs and Corms with Scented Flowers 1, 2, 3, 4, 5
Scented Plants of Climbing and Trailing Habit 1, 2, 3
Winter-flowering Plants with Scented Flowers 1, 2
Night-scented Flowering Plants 1, 2
Scented Aquatic Plants.
Plants with Scented Fruits.
Plants with Scented Roots 1, 2
Trees and Shrubs with Scented Wood.
Trees and Shrubs with Scented Gums.
Scented Cacti and Succulents.
Plants bearing Flowers or Leaves of Unpleasant Smell 1, 2

Flower Perfume Group:-
Miscellaneous Group with scents - Balm, Brandy, Cedar, Cloying, Cowslip, Cucumber, Damask Rose, Daphne, Exotic, Freesia, Fur-like, Gardenia, Hay-like, Heliotrope, Honeysuckle, Hops, Hyacinth, Incense-like, Jasmine, Laburnham, Lilac, Lily of the Valley, Meadowsweet, Mignonette, Mint, Mossy, Muscat, Muscatel, Myrtle-like, Newly Mown Hay, Nutmeg, Piercing, Primrose, Pungent, Resinous, Sandalwood, Sassafras, Seductive, Slight, Soft, Stephanotis, Sulphur, Starch, Sweet, Sweet-briar, Tea-rose, Treacle and Very Sweet.

Flower Perfume Group:-
Indoloid Group.
Aminoid Group with scent - Hawthorn.
Heavy Group with scents -
Jonquil and
Lily.
Aromatic Group with scents - Almond,
Aniseed, Balsamic,
Carnation, Cinnamon, Clove,
Spicy and
Vanilla.
Violet Group.
Rose Group.
Lemon Group with scent -
Verbena.
Fruit-scented Group with scents -
Apricot,
Fruity,
Green Apple,
Orange, Pineapple,
Ripe Apple , Ripe Banana and
Ripe Plum.
 

Flower Perfume Group:-
Animal-scented Group with scents -
Cat,
Dog,
Ferret,
Fox,
Goat,
Human Perspiration,
Musk,
Ripe Apple and
Tom Cat.
Honey Group.
Unpleasant Smell Group with scents -
Animal,
Fetid,
Fishy,
Foxy,
Fur-like,
Garlic,
Hemlock,
Manure,
Nauseating,
Perspiration,
Petrol,
Putrid,
Rancid,
Sickly,
Skunk,
Stale Lint
Sulphur and
Urinous,

 

Leaf Perfume Group:-
Turpentine Group.
Camphor and Eucalyptus Group.
Mint Group.
Sulphur Group.
Indoloid Group.
Aminoid Group.
Heavy Group.
Aromatic Group.
Violet Group.
Rose Group.
Lemon Group.
Fruit-scented Group.
Animal-scented Group.
Honey Group.

Scent of Wood, Bark and Roots Group:-
Aromatic Group.
Turpentine Group.
Rose Group.
Violet Group.
Stale Perspiration Group.

 

Scent of Fungi Group:-
Indoloid Group.
Aminoid Group.
Sulphur Group.
Aromatic Group.
Rose Group.
Violet Group.
Fruit Group.
Animal Group.
Honey Group

 

There are other pages on Plants which bloom in each month of the year in this website:-

 

 

 

 

 

PLANTS PAGE
MENU
Introduction
Site Map

This topic has many pages of useful plant lists